KEGG   Nocardia cyriacigeorgica: NOCYR_4780Help
Entry
NOCYR_4780        CDS       T01756                                 

Definition
putative formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ncy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5277134..5278000
Genome map
AA seq 288 aa AA seqDB search
MPELPEVEALAQFLREHAVGAVVGRVDVAALSAVKTFDPPVTALSGRDVTGAGRWGKFLG
MDCGGLWLITHISRGGWLRWSDNPSATPPKPGKGPLALRVHFFTPEGATPAFDLTEAGTK
KRLAVYIVDDPHQVPGISRLGPDALEVTEDQFAEILGGSTQRIKTALVEQSLLAGIGNAY
SDEILHTARISPFATAKSLSADKVSELYEAMRTVLLDAVQRSVGQDAARLKGEKRSGMRV
HARTGLPCPVCGDTVREVSFAERSFQYCPTCQTGGKILADRRMSRLLK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactaccggaagtggaggcgctggcgcagtttctgcgggaacacgcggtcggc
gcggtggtcgggcgcgtggacgtggcggcgctgagcgcggtcaagaccttcgacccgccg
gtgacggcgctgtccggtcgcgatgtcacgggcgcgggccggtggggcaagttcctcggc
atggactgcggcggcctatggctgatcacccacatctcgcgcggcggatggctgcgctgg
tccgacaatcccagcgcgaccccacccaaaccgggcaagggcccgctggccctgcgggtg
catttcttcactcccgagggcgccacacccgccttcgacctcaccgaagcgggtaccaag
aaacggctcgcggtctacatcgtcgacgacccgcaccaggtccccggcatcagccggctg
ggccccgacgcgctcgaggtcaccgaagaccagttcgccgaaatcctcggcggcagcacc
cagcggatcaagaccgcgctggtggagcagtcgctgctggcgggcatcggcaacgcctac
tccgacgagatcctgcacactgcccgcatctcgccgttcgccaccgcgaaatcgctgtcc
gcggacaaggtctcggaactctacgaggccatgcgcaccgtgctgctggatgccgtgcaa
cgctccgtcggccaggacgcggcccggctcaagggcgaaaagcgttcggggatgcgggta
cacgcgcgcaccggcctaccgtgcccggtctgcggcgacacggtgcgggaggtgtcgttc
gccgagcgctccttccagtactgccctacctgtcagaccggcggcaagatcctcgccgac
cggcgcatgtcgcggttgctcaaatag

DBGET integrated database retrieval system