KEGG   Nocardia cyriacigeorgica: NOCYR_4788Help
Entry
NOCYR_4788        CDS       T01756                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ncy00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ncy00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5284906..5285406
Genome map
AA seq 166 aa AA seqDB search
MSSARVIGLIWAQTPDGVIGVDNRIPWRVPEDMANFKQVTLGHPVVMGRRTWDSLPPRFR
PLTGRRNIVVTRQPDWAAEGAERSASLPEALELTAPDDVWIMGGGEIYRAAMEYATELLV
TEIDLDVAGDAFAPTIDSHWQTDADTPWQQSSAGPRYRIRRFIRRR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcggcacgcgtcatcggcctgatctgggcccagacccccgacggggtgatcggc
gtcgacaaccgcatcccctggcgggtgcccgaggacatggccaacttcaaacaggtcacc
ctcggccatccggtggtgatgggcaggcgcacctgggattcgctgccgccgcgcttccgt
ccgctgaccgggcgccgcaatatcgtggtgaccaggcaaccggactgggccgccgagggc
gccgaacgcagcgcctcgctaccggaggcgctcgagctgaccgcgcccgatgacgtctgg
atcatgggcggcggcgaaatctatcgcgccgcaatggaatacgccaccgaactgctcgtc
accgaaatcgacctggacgtggcgggtgacgccttcgcccccaccatcgactcgcactgg
cagaccgacgccgacacgccgtggcagcagtccagtgcgggaccgcggtaccggatccgc
agattcatccgacgccgctga

DBGET integrated database retrieval system