KEGG   Nocardia cyriacigeorgica: NOCYR_4971Help
Entry
NOCYR_4971        CDS       T01756                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase, porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ncy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5556818..5557738)
Genome map
AA seq 306 aa AA seqDB search
MAETSLEPRHLVLPMFVADGIDAPREIGSMPGVQQHSMDSLRKAAVEAVSAGVGGLMLFG
VPRPEDKDATGSGATDPDGILNRGLRALAEEVGSATVIMADTCLDEFTDHGHCGVLADDG
SVDNDATLDRYVEMAIAQAEAGADLLGTSGMMDGQVGAIRGGLDATGHLDTGILAYAAKY
ASAFYGPFREAVGSSLQGDRRTYQQDPANRRESLREVELDLAEGADLVMVKPAMSYLDIL
REVADRSTVPVAAYQISGEYAMITAAAERGWIDRRGAILESLIGIRRAGADIVLTYWATE
AAHWLS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagacctcgctcgagccgcggcatctggtgctgccgatgttcgtggccgacggc
atcgacgcaccgcgcgagatcggatccatgccgggtgtgcagcagcattcgatggattcg
ctgcgcaaggccgcggtcgaggcggtatcggccggtgtcggcgggctgatgctgttcggg
gtgccgcgtccggaggacaaggacgccaccggcagcggggccaccgatccggacggcatt
ctgaaccgcggactgcgcgcccttgccgaggaggtcggctccgccacggtgatcatggcc
gacacctgcctggacgagttcaccgatcacggccactgcggtgtgctggccgacgacggc
tcggtggacaacgacgccaccctcgaccgctacgtcgagatggccatcgcccaagccgag
gccggcgccgatctgctcggcaccagcggcatgatggacggccaggtcggcgcgatccgc
ggcggtctcgacgccaccggccacctcgataccgggatcctcgcctacgccgcgaaatac
gcctcggccttctacgggcccttccgggaggccgtcggctcctcgctccagggcgaccgg
cgcacctaccagcaggatccggccaaccgccgcgaatcgctgcgcgaggtggaactggac
ctggccgaaggcgccgacctggtgatggtgaagccggccatgtcctacctggacatcctg
cgcgaggtcgccgaccgctccacggtgccggtcgcggcctatcagatctccggcgagtac
gcgatgatcaccgccgccgccgaacgcggctggatcgaccgtcgcggcgccatcctcgaa
tcgctgatcggtatccgccgggcgggtgcggacatcgtgctcacctactgggcgaccgag
gcggcgcactggctgtcgtga

DBGET integrated database retrieval system