KEGG   Nocardia cyriacigeorgica: NOCYR_4974Help
Entry
NOCYR_4974        CDS       T01756                                 

Definition
putative uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase Porphyrin biosynthesis protein hemD [Includes: Uroporphyrinogen-III C-methyltransferase (Urogen III methylase) (SUMT) (Uroporphyrinogen III methylase) (UROM); Uroporphyrinogen-III
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NOCYR_4974
Enzymes [BR:ncy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     NOCYR_4974
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NOCYR_4974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5561110..5562672)
Genome map
AA seq 520 aa AA seqDB search
MSRAAKKHPGRILFVGSGPGDPALLTVRAREVLGRATLAFTDPDVDKGVLALIGTAVEPG
PDGEPAVDVRPALGEPAEVAKTLIAEARAGHDVVRVVAGDPLTTDAVIAEVTTVTRSHMV
FEVLPGLPGGSAVPSYAGIALGSGHTEADVRGEVDWAALAAAPGPLVLHATSGHLAETAS
ALVEHGMAPQTPVAVTVRGTTRQQRTIEATLATLNSAASELVGPLVVTIGKVVAQRSKMS
WWESRALYGWTVLVPRTKDQAAEMSERLVTHGAIPMEVPTIAVEPPRSPAQMERAVKGLV
DGRYQWVVFTSTNAVRAVWEKFSEFGLDARAFSGVKIACVGEATADKVRSFGINPELLPS
GEQSSEGLLADFPPYDDVFDPVNRVLLPRADIATETLAEGLRDRGWEIDDVTAYRTVRAS
PPPAETREMIKTGGFDAVLFTSSSTVRNLVGIAGKPHARTIVACIGPKTAETAIEFGLRV
DVQPETAQVGPLVEALAEHAARLRAEGLLPPPRKKSRRSR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgagccgctaagaagcatcccggtcggatcctgttcgtcgggtcgggtccagga
gatccggcgctgctcaccgtgcgggcccgcgaggtgctcggccgggcaacgctcgccttc
accgaccccgatgtcgacaagggtgtgctcgccctgatcggcacggccgtcgagccggga
cccgacggcgagcccgccgtcgacgtgcggcccgctctcggtgagccggccgaggtcgcc
aagacgctgatcgccgaggcccgcgccggacacgatgtggtgcgcgtggtcgccggcgat
ccgctgaccaccgacgcggtgatcgccgaggtcaccaccgtgactcgctcgcacatggtg
ttcgaggtgctgccgggtctgcccggtgggtcggcggtgccgagctacgccggtatcgca
ctgggatcgggccacaccgaggccgatgtgcgcggcgaggtggactgggcggcactggcc
gccgcgcccgggccgctggtgctgcacgccacctccggacacctggccgagaccgccagc
gcgctggtcgagcacggtatggccccgcagacgccggtcgcggtgaccgtgcgcggcacc
acccggcagcagcgcaccatcgaagccaccctggccacgctcaacagcgccgcctccgaa
ctggtgggcccactggtggtgaccatcggcaaggtggtcgcgcagcggtcgaagatgtcg
tggtgggaatcgcgggcactgtacggctggaccgtgctggtgccgcgcaccaaggatcag
gccgccgagatgagcgagcgcctggtcacccacggcgccatcccgatggaagtgccgacc
atcgcggtcgagccgccgcgcagccccgcgcagatggagcgcgcggtcaagggcctggtc
gacggccgctaccagtgggtggtgttcacctccaccaacgcggtgcgcgcggtgtgggag
aagttctccgagttcggactggacgcgcgggcgttctccggggtgaagatcgcctgcgtc
ggcgaggccaccgcggacaaggtgcgctcgttcggcatcaacccggaactgctgcccagc
ggtgaacagtcctccgagggcctgctcgccgacttcccgccctacgacgacgtgttcgat
ccggtgaaccgggtgctgctgccgcgcgccgatatcgccaccgagacgctggccgagggg
ctgcgcgaccgcggctgggaaatcgacgacgtcaccgcctaccgcacggtgcgtgcctcg
ccgccgccggccgagacccgcgagatgatcaagaccggtggtttcgacgcggtcctgttc
acctcgtcctccaccgtccgcaacctggtcggtatcgccggtaagccgcacgcccgcacc
atcgtcgcgtgcatcggccccaagaccgccgagaccgccatcgagttcggcctgcgcgtg
gacgtgcagccggaaaccgcccaggtcggcccgctggtggaggccctggccgagcatgcc
gcccggctgcgcgccgagggcctgctgcccccgccgcgcaagaagagccgccgcagccgc
tag

DBGET integrated database retrieval system