KEGG   Nocardia cyriacigeorgica: NOCYR_4993Help
Entry
NOCYR_4993        CDS       T01756                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (dPGM)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NOCYR_4993 (gpmA)
   01230 Biosynthesis of amino acids
    NOCYR_4993 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_4993 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    NOCYR_4993 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NOCYR_4993 (gpmA)
Enzymes [BR:ncy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NOCYR_4993 (gpmA)
Exosome [BR:ncy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NOCYR_4993 (gpmA)
  Exosomal proteins of melanoma cells
   NOCYR_4993 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5582407..5583144)
Genome map
AA seq 245 aa AA seqDB search
MTYTLVLLRHGESEWNALNLFTGWVDVHLTDKGIAEGKRAGELLAEHGILPDIVYTSLLR
RAISTANIALDAADRHWIPVVRDWRLNERHYGELQGKNKAQIRDKYGDEQFMLWRRSYDT
PPPPIEADNEYSQSGDARYAGIEVPRTECLLDVVNRMVPYWESTISKELLSGKTVLVAAH
GNSLRALVKHLDQISDDDIAGLNIPTGIPLRYELDENLRPVRPREYLDPEAAAAGAAAVA
GQGGK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacaccctcgtgttgctgcgccacggcgagagcgaatggaatgccctgaatctg
ttcaccggctgggtggacgtccatctgacggacaagggcatcgccgagggcaagcgggcc
ggtgagctgctggccgagcacggcatcctgcccgacatcgtctacacctcgctgctgcgc
cgcgcgatcagcaccgccaatatcgccctcgacgccgccgaccggcactggattccggtc
gtgcgcgactggcgcctcaacgagcgccactacggcgagttgcagggcaagaacaaggcc
cagatccgcgacaagtacggcgacgagcagttcatgctgtggcggcgcagctacgacact
ccgccgccgccgatcgaggccgacaacgagtacagccagagcggcgacgcccgctacgcc
gggatcgaggtcccgcgcaccgaatgcctgctcgacgtggtgaaccggatggtgccctac
tgggagtcgaccatctccaaggagctgctctcgggtaagaccgtgctggtcgccgcgcac
ggcaactcgctgcgcgccctggtcaagcacctcgatcagatctccgatgacgacatcgcc
ggcctgaacatccccaccggtatcccgctgcgctacgaactcgacgagaacctgcgcccg
gtgcgtccgcgcgagtacctcgatccggaggccgcggccgccggtgccgcagccgtcgcc
ggccagggcggcaagtaa

DBGET integrated database retrieval system