KEGG   Nocardiopsis dassonvillei: Ndas_0047Help
Entry
Ndas_0047         CDS       T01248                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Ndas_0047
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Ndas_0047
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Ndas_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(58697..59530)
Genome map
AA seq 277 aa AA seqDB search
MTTHEFPSGTARQATRPPVPGTAGNPRTTRVDLTGRTALVTGAASGIGRACALRLADAGA
RVRMVDLDGRALDELADRGVGEAVELDLTDLDAAEEAARGADVVVNNAGVQTVAPVQDFP
PERFSLILRLMVESPFRVVRGALPHMYARGWGRVVNISSVHGLRASAYKSAYVTAKHGLE
GFSKVVALEGAAHGVTSNCVNPGYVRTPLVERQIADQAAAHGIPEERVLSEVLLARSPLK
RLIEPSEVAELVAYLCGEDASFVNGASLPVDGAWSAS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcacgagttcccgtcgggcacggcgcggcaggccacccggccccccgttccc
ggaacggcggggaacccccgcaccacccgggtcgacctcaccggaaggaccgcgctggtg
accggtgcggccagcggcatcggcagggcgtgcgccctgcgcctggcggacgccggagcc
cgggtccggatggtcgacctcgacgggcgggccctggacgaactggccgaccggggcgtc
ggcgaggcggtggagctggatctgaccgacctggacgccgccgaggaggccgcgcggggc
gcggacgtcgtggtcaacaacgcgggcgtccagacggtcgcgcccgtccaggacttccct
ccggagcgtttctccctcatccttcgtctcatggtcgagtcgccgttccgcgtggtgcgc
ggcgccctgccccacatgtacgcacgggggtggggccgcgtcgtcaacatctcctcggtg
cacgggctgcgcgcctcggcctacaagtcggcctacgtgaccgccaagcacggcctggag
ggcttctcgaaggtggtggccctggagggcgccgcacacggggtgacctccaactgtgtg
aaccccggatacgtgcgcaccccgctggtggagaggcagatcgccgaccaggcggcggcg
cacggcattccggaggagcgggtgctctcggaggtcctgctggcccggagcccgctcaag
cggctgatcgagccctccgaggtcgccgagctggtcgcctacctgtgcggtgaggacgcg
tcgttcgtcaacggcgcctccctgcccgtggacggagcatggagcgcgagctga

DBGET integrated database retrieval system