KEGG   Nocardiopsis dassonvillei: Ndas_0060Help
Entry
Ndas_0060         CDS       T01248                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_0060
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ndas_0060
   00640 Propanoate metabolism
    Ndas_0060
   00660 C5-Branched dibasic acid metabolism
    Ndas_0060
Enzymes [BR:nda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ndas_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:77516..78697
Genome map
AA seq 393 aa AA seqDB search
MDLFEYQAKQLFAEYGVPVPQGKVASTAAEARAIADEFAAAGKPRVVVKAQVKTGGRGKA
GGVKVAEGPEDAQAKAEQILGMDIKGHTVHRVLVEEASDIAEEYYFSFLLDRANRTFLSI
CSAEGGMDIEEVAETNPDAVAKFPVDALTGAPASIAAEIVKAGKLPEAATEGATEVITKL
WDAFVGKDATLVEVNPLILTKDGRVVALDGKVTLDENAEFRQDLESLTFAEEGDPLEVAA
KAKGLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAEVMAN
GLDIILGDPSVKSVFVNVFGGITACDAVANGIVQALELLESRGDDVSKPLVVRLDGNNAE
LGREILTKRAHPAVRQVDTMDGAAAQAAELAAK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaataccaggcgaagcaactcttcgcagagtacggggttcccgtaccc
caggggaaggtggcgagcacggccgctgaggcgcgtgccatcgctgatgagttcgccgcc
gccggcaagccccgcgtcgtcgtcaaggcgcaggtcaagaccggtggtcgcggcaaggcc
ggcggcgtcaaggtcgccgagggccccgaggacgcccaggccaaggccgagcagatcctc
ggcatggacatcaagggccacacggtccaccgtgtcctggtcgaggaggcctccgacatc
gcggaggagtactacttctccttcctgctggaccgcgcgaaccgcaccttcctgtccatc
tgctccgccgagggcggcatggacatcgaggaggtcgccgagaccaaccccgacgccgtc
gccaagttcccggtcgacgccctgaccggcgctcccgccagcatcgcggcggagatcgtc
aaggcgggcaagctgcccgaggccgcgaccgagggcgcgaccgaggtcatcaccaagctg
tgggacgccttcgtcggcaaggacgccaccctcgtcgaggtgaacccgctcatcctgacc
aaggacggccgggtcgtcgccctggacggcaaggtcaccctggacgagaacgccgagttc
cgccaggacctggagagcctcaccttcgccgaggagggtgaccccctggaggtcgccgcc
aaggccaagggcctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggc
gcgggtctggtcatgtccaccctggacgtggtcgcctacgccggcgaggcgcacggcggc
gtcaagcccgccaacttcctggacatcggcggcggcgcctcggccgaggtcatggccaac
ggcctggacatcatcctgggcgacccctcggtcaagagcgtgttcgtcaacgtcttcggc
ggcatcaccgcctgcgacgcggtggccaacggcatcgtccaggccctggagctgctcgag
agccgcggcgacgacgtcagcaagccgctggtcgtgcgtctggacggcaacaacgccgag
ctgggccgcgagatcctcaccaagcgggcccacccggccgtgcgacaggtcgacacgatg
gacggcgccgccgctcaggccgccgagctcgcggcgaagtag

DBGET integrated database retrieval system