KEGG   Nocardiopsis dassonvillei: Ndas_0090Help
Entry
Ndas_0090         CDS       T01248                                 

Definition
(GenBank) magnesium protoporphyrin chelatase, putative
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00860  Porphyrin and chlorophyll metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ndas_0090
Enzymes [BR:nda01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ndas_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Mg_chelatase AAA_5 AAA_3 AAA_PrkA AAA_16 NACHT AAA_22 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ADH65541
UniProt: D7B6Y7
Position
1:complement(113966..115399)
Genome map
AA seq 477 aa AA seqDB search
MSALPEAPSPAPPPLPRTRADLRGSGHVHRPVAAEVRENLLRRMASGRPRFPGVHGFDAT
VLPQVERALLAGHDIVLLGERGQGKTRLIRTLATLLDEWSPAVAGCPVNDHPYTPVCPAC
VRRSAREGDGLPVVWRHRSERYGEKLGTPDTGVGELIGDVDPALLARGRSLGDPETIHYG
LVPRANRGVFCVNELPDLPARAQVALFNVLEERDLQVRGYNLRLPLDLLLVASANPEDYT
SRGRIVTPLKDRFGAQVRTHYPLTLADELALIRQEAALPEGTTVPSHLLEAVARFTRLVR
ASKKVDARSGVSVRFSVSAAETVAASALRRAALTGGEVPVARVCDLPAAVEPLLGKVEFE
TGSEGREAEILHALLRRAVAEVFRERLGTADLSELADRFSGGGTVETGDLVGAAELLRRV
GAVPGLAAMIGHAAPEDEDGPPTPGLAAAVVEFALEGLYLERRLSKDALPDGGVYRF
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcccttcccgaagccccctcccccgccccgcccccgctcccgcgcacccgcgcg
gacctgcgcggatccgggcacgtccaccgaccggtcgccgccgaggtgcgggagaacctg
ctgcggcggatggcctcgggacggccccggttccccggggtgcacgggttcgatgccacc
gtgctgccgcaggtggagcgggccctgctggccggacacgacatcgtcctgctgggcgag
cgcggccagggcaagacccggctgatccgcaccctggcgaccctgctggacgagtggtcc
ccggcggtggccgggtgcccggtcaacgaccacccctacacgccggtctgcccggcctgc
gtgcgccgttcggcacgggagggcgacggcctgccggtcgtgtggcggcaccgctcggag
cgctacggcgagaagctgggcacgcccgacaccggcgtgggcgagctgatcggcgacgtg
gacccggcgctgctggcgcgggggcgctccctcggcgatcccgagaccatccactacggt
ctggtgccgcgggccaaccggggcgtgttctgcgtcaacgagctgcccgacctgcccgca
cgggcccaggtggcgctgttcaacgtgctggaggagcgcgacctccaggtacgcggctac
aacctgcggctgccgctggacctgcttctggtggcgagcgcgaacccggaggactacacg
agccggggacgcatcgtcaccccgctcaaggaccgcttcggcgcgcaggtgcgcacccac
tacccgctgaccctggcggacgaactggcgctcatccggcaggaggcggcgctgcccgag
ggcacgacggtgccctcgcacctgctggaggccgtggcgcgcttcacccggctggtccgc
gcctcgaagaaggtggacgcccgttcgggggtgtcggtgcgcttctcggtgtccgcggcc
gagacggtggcggcgtcggcgctgcgccgggctgccctgaccggcggggaggttccggtg
gcccgggtgtgcgacctgcccgccgcggtggagccgctgctgggcaaggtcgagttcgag
acgggttccgagggccgcgaggcggagatcctgcacgcgctgctgcgccgggcggtggcg
gaggtgttccgcgaacgcctgggaacggcggacctgtccgaactcgccgaccgcttctcg
ggcggcggcacggtggagaccggtgacctggtgggcgccgccgaactgctgcggcgggtg
ggcgcggtcccgggactcgcggcgatgatcgggcacgcggcccccgaggacgaggacggc
ccgccgacgccggggctggccgccgctgtggtggagttcgcgctggagggcctgtacctg
gagcgccggctgtccaaggacgcgcttcccgacggaggggtctaccgcttctag

DBGET integrated database retrieval system