KEGG   Nocardiopsis dassonvillei: Ndas_0246Help
Entry
Ndas_0246         CDS       T01248                                 

Definition
(RefSeq) 1,4-alpha-glucan branching protein (EC:2.4.1.18)
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ndas_0246
Enzymes [BR:nda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ndas_0246
Exosome [BR:nda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ndas_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(301922..304441)
Genome map
AA seq 839 aa AA seqDB search
MTSPRSEQRPRASAAKTATNGKNPKKKAVESIPVVEEVSVAETAAAVEPAAGKPAGGKAA
KAVRKAATAGTGEKAPAASKGRASANGRAAAKGRAATNGRAATAKPPAASRRKGPDPELV
AALDRLVDGHHHDPHALLGVHAEGRGTVVRALRPGAVEVHAVLADGSRLRLDHLHRGVFS
AKVSRSRLGSVPDYRISARYEDGAEHVAADPYRFAPTLGELDLHLIGEGRHEELWNALGA
HVRVEDTAMGEVAGTRFAVWAPDARGVRMIGDFNHWSGVGHPMRSLGSSGVWELFVPGIG
EGGLYKFQVLGADGHWRDKADPMARCTQMPPATASVVTSSTHVWSDQEWMAERKGVEQHR
APMSVYEVHLGSWRPGLGYAELAEELVAYVTDMGFTHVEFLPVAGHPYDGSWGYQVTSYY
APTPRFGTPDEFRHLVDALHRAGVGVLLDWVPAHFPKDEWALARFDGSALYEHPDPRRGE
HPDWGTLIFNYGRTEVRNFLVANALYWLEEFHVDGLRVDAVASMIYLDYSRDSGAWEPNV
FGGRENLEAIDFLKELNTTVYRRNPHVAMIAEESTAYTGVTTPVDHGGLGFGFKWNMGWM
HDTLEYVKKEPVHRQYHHDDVTFSMVYAYSENYVLPLSHDEVVHGKQSLFNKPPGDEWQR
SATLRALLAFMWSHPGKQLLFMGGEIAQGDEWSHREGVPWWLLQFEHHAGVQRLVRTLNE
AYRPRAALWSQDTEPAGFTWLDGGDREGNTLSYLRHGDDGSVLACAVNFSPVPRTGRRMG
LPSGGRWNAVLNTDEARFGGSDHPAPARVDAEPVPWDGQPFSAEVVLPPLGAVWFEPGS
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcgccgcgcagcgaacaacgtccgcgtgccagcgcagccaagactgcgacgaac
gggaagaacccgaagaagaaggccgtggagagcatcccggtcgtggaggaggtgtcggtc
gccgagacggcggccgcggtggaacccgccgccgggaagcccgcggggggcaaggcggcc
aaggccgtcaggaaggccgcgacggcggggaccggtgagaaggccccggcagcctccaag
ggcagggcctccgcgaacgggagggccgcagcgaagggcagggccgcgacgaacggcagg
gccgcgacggcgaaaccaccggccgcctcccggcgcaaggggcccgaccccgaactggtc
gccgccctggaccggctggtggacggccaccaccacgacccgcacgcgctgctgggcgtg
cacgccgagggccggggcaccgtggtgcgggccctgcggccgggcgcggtggaggtgcac
gccgtcctggccgacggctcgcggctgcgcctggaccacctgcaccggggcgtgttctcc
gcgaaggtgtcccggagcaggctcggctccgtgcccgactaccggatcagcgcccgctac
gaggacggcgccgaacacgtggccgccgacccgtaccggttcgcgccgaccctgggcgag
ctggacctgcacctgatcggcgagggccgccacgaggagctgtggaacgccctcggagcg
cacgtgcgggtcgaggacaccgcgatgggagaggtggccggaacccggttcgcggtgtgg
gcgccggacgcgcgcggcgtgcggatgatcggcgacttcaaccactggagcggcgtcggg
cacccgatgcggagcctgggatccagcggtgtgtgggagctgttcgtgcccgggatcggt
gagggcggcctgtacaagttccaggtcctgggcgccgacgggcactggcgcgacaaggcc
gacccgatggcgcggtgcacgcagatgccgcccgcgaccgcctccgtggtcacctcctcc
acgcacgtgtggtccgaccaggagtggatggccgagcgcaagggcgtggagcagcaccgg
gcgccgatgagcgtgtacgaggtgcacctgggctcctggcggcccgggctgggctacgcc
gagctggccgaggaactcgtcgcgtacgtgaccgacatggggttcacgcacgtggagttc
ctgcccgtggcgggccacccctacgacggttcctggggataccaggtgacctcgtactac
gcgcccacgccccggttcggcacgccggacgagttccgccacctggtggacgccctgcac
cgcgcgggggtcggcgtgctgctggactgggtgcccgcgcacttccccaaggacgagtgg
gcgctggcccgcttcgacgggagcgcgctgtacgagcaccccgacccgcgccggggcgag
cacccggactggggaacgctgatcttcaactacgggcggaccgaggtgcgcaacttcctc
gtggccaacgccctgtactggttggaggagttccacgtcgacggcctgcgggtggacgcg
gtggcctcgatgatctacctggactactcgcgcgactccggggcctgggagccgaacgtg
ttcggcggcagggagaacctggaggcgatcgacttcctcaaggagctcaacaccaccgtc
taccggcgcaacccgcacgtggcgatgatcgcggaggagtccaccgcctacacgggcgtg
accacgccggtggaccacggcgggctcggcttcgggttcaagtggaacatggggtggatg
cacgacaccctggagtacgtcaagaaggagccggtccaccgccagtaccaccacgacgac
gtcacgttctcgatggtctacgcctacagcgagaactacgtgctgccgctgtcgcacgac
gaggtggtgcacggcaagcagtcgctgttcaacaagccgcccggcgacgagtggcagcgg
tcggcgaccctgcgcgcgctcctggcgttcatgtggtcccacccgggcaagcagctgctg
ttcatgggcggggagatcgcccagggcgacgagtggtcgcaccgggagggcgtgccgtgg
tggctgctccagttcgagcaccacgcgggggtgcagcgcctggtgcggacgctcaacgag
gcctaccggccccgggccgcgctgtggtcccaggacaccgaaccggcgggcttcacctgg
ctggacggcggtgaccgcgaggggaacacgctgtcgtacctgcgccacggcgacgacggc
tctgtgctcgcctgcgcggtgaacttctcgccggtgccccgtacggggcggcggatgggc
ctgccctccgggggccggtggaacgcggtgctcaacaccgacgaggcgcgcttcggcggg
tcggaccacccggcgcccgcccgcgtggacgccgagcccgtgccctgggacgggcagccg
ttctcggcggaggtcgtcctgcccccgctcggcgcggtctggttcgagcccgggtcctag

DBGET integrated database retrieval system