KEGG   Nocardiopsis dassonvillei: Ndas_0319Help
Entry
Ndas_0319         CDS       T01248                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ndas_0319
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_0319
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ndas_0319
Enzymes [BR:nda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ndas_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:395244..396302
Genome map
AA seq 352 aa AA seqDB search
MARAWRGIVEEYRDRLPVNESTPVVTLQEGGTPLLPATRVSELTGCEVFLKVEGLNPTGS
FKDRGMTMAITKAAEDGAKAVICASTGNTSASAAAYAIRAGMTCAVLVPQGKIAMGKLAQ
ALVHGARLLQVDGNFDDCLELARKLSVDYPVALVNSVNPYRLQGQKTAAFEIVDALGDAP
DVHCIPVGNAGNITAYWMGYTEYSRDGISTRNPRMLGFQASGSAPIVNGAPVTSPSTIAT
AIRIGNPASWKLAEQARDESGGLIDKVTDRQIMAAYKLLAAEEGVFVELASAASVAGLLQ
SVQAGLVEPGSRVVCTVTGNGLKDPDWALAGASSATTVPVDALAAAQALDLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcacgggcgtggcgaggcatcgtcgaggagtaccgcgaccgcctccccgtcaacgag
agcacccccgttgtcaccctccaggagggcggcacgcccctgctgcccgccacgcgcgtg
tccgagctcacgggctgcgaggtcttcctcaaggtcgaggggctcaaccccaccgggtcc
ttcaaggaccgcggcatgaccatggccatcaccaaggccgccgaggacggcgccaaggcc
gtcatctgcgcctccaccggcaacaccagcgccagcgccgccgcctacgccatccgcgcg
ggcatgacctgcgccgtgctggtgccccagggcaagatcgccatgggcaagctggcccag
gccctcgtccacggcgcccgcctgctccaggtcgacggcaacttcgacgactgcctcgaa
ctggcccgcaagctcagcgtggactacccggtcgccctggtgaactcggtcaacccctac
cgcctccaggggcagaagaccgccgccttcgagatcgtcgacgccctcggcgacgccccc
gacgtccactgcatccccgtgggcaacgcgggcaacatcaccgcctactggatgggctac
accgagtactccagggacgggatctccacccgcaacccgcgcatgctcggcttccaggcc
agcggctccgcgcccatcgtcaacggcgcgcccgtcaccagcccgagcaccatcgccacc
gccatccgcatcggcaacccggcctcctggaagctggccgagcaggcccgcgacgagtcc
ggcggcctcatcgacaaggtcaccgaccgccagatcatggccgcctacaagctcctcgcc
gccgaggagggcgtgttcgtggagctggcctccgccgccagcgtggccggtctgctccag
tccgtccaggcggggctggtcgagcccggcagccgcgtggtgtgcaccgtgaccggcaac
ggcctcaaggaccccgactgggcgctggccggagcctcctccgccaccaccgtcccggtc
gacgccctcgccgcggcccaggccctcgacctggcctga

DBGET integrated database retrieval system