KEGG   Nocardiopsis dassonvillei: Ndas_0464Help
Entry
Ndas_0464         CDS       T01248                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nda  Nocardiopsis dassonvillei
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Ndas_0464
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Ndas_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(557848..559821)
Genome map
AA seq 657 aa AA seqDB search
MPPERSTDPTATPSSSAPTSRTAAETPTETPTGTRAETGSATGDRADRFDYDVLVVGSGF
GGSVSALRLTEKGYRVGVLEAGRRFTPQTLPSSSWDVRNFLWAPRLGMYGIQRIHLLRDV
VILAGAGVGGGSLNYANTLYHPLDPFFEDPQWRHITDWKSELAPFYDQARRMLGVRTNPT
VTPSDVHMKAIAEDMGVGHTFRLTPVGVCFGDGRDGDGRRAEPGASVGDPYFGGAGPDRR
ACTECGECMTGCRHGAKNALTENYLYFAERDGAEVHPLTTVERLRELPGGGFAADTVRTD
APRRRSSARTFTARQVVVAAGTYNTQTLLHRMRDSGALPRLSARLGTLTRTNSEALVGAM
TRRVRPQEDLTRGVAITSSIHPDENTHIEPVRYGKGSNAMALLTAMQVPGGGRIPRWLRF
LGLAARHPVVFARSLSARRWSERTIIGLVMQSLDNSLTTSVRRGPLGGRKRLTSRQGHGE
PNPTWIPAGQDAATRLAERIDGFPGGTVGDVFNVPMTAHFLGGCPIGDSPETGVIDPYHR
LYGHPGVHVVDGSAVTANLGVNPSLTITAQAERAMSMWPNKGEEDTRPEQGERYRRVGPV
FPASPAVPAGAFAELRFTAPLPLSVVDSEAPSADAAAVGGTTGAAGETGADGEDART
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgcccccagagcgcagcacagatcccaccgccacccccagctcctccgctcccacctca
cggaccgcggccgaaaccccaaccgaaaccccgaccggaaccagggccgagaccggatcc
gcgaccggtgaccgcgccgaccgcttcgactacgacgtcctggtcgtgggctcgggcttc
ggcggttcggtgagcgccctgcgcctcaccgagaagggctaccgcgtcggcgtcctggag
gcggggcgccgcttcacgccccagacgctgccctcctcgtcctgggacgtccgcaacttc
ctgtgggcgccccggctcggtatgtacggcatccagcgcatccacctgctgcgcgacgtg
gtgatcctggcgggggccggcgtcggcggcggttccctcaactacgccaacacgctgtac
cacccgctggacccgttcttcgaggacccgcagtggcggcacatcaccgactggaagtcg
gagctggcgccgttctacgaccaggcccgccgcatgctcggcgtgcgcaccaaccccacc
gtcaccccctccgacgtgcacatgaaggcgatcgccgaggacatgggcgtggggcacacc
ttccgtctcaccccggtgggcgtgtgcttcggcgacggacgggacggcgacggccgccgg
gccgagcccggcgcgtccgtgggggacccctacttcggcggcgcgggccccgaccggcgt
gcctgcacggagtgcggggagtgcatgaccggatgccgccacggcgccaagaacgccctg
accgagaactacctgtacttcgccgagcgcgacggcgccgaggtgcacccgctgaccacc
gtcgagcggctgcgcgaactgccgggcggcggcttcgccgccgacaccgtcaggaccgac
gcgccccggcggcggtcgagcgcccgcacgttcaccgcccgccaggtggtcgtggccgcc
gggacctacaacacccagacgctgctgcaccgcatgcgcgactcgggcgcgctgccccgc
ctgtcggcgaggctgggcacgctcacccgcaccaactccgaggctctcgtcggcgcgatg
acccgccgggtgagaccgcaggaggacctgacccggggcgtggccatcacgtcctcgatc
cacccggacgagaacacccacatcgaaccggtccgctacggcaagggctccaacgcgatg
gcgctgctcaccgcgatgcaggtgcccggcggcgggcggatcccgcgctggctgcggttc
ctggggctggccgcgcgccacccggtggtgttcgcccgcagcctctccgcccgccgctgg
tcggagcggaccatcatcggcctggtgatgcagtcgctggacaactcgctgacgacgtcg
gtgcggcgggggccgctgggcgggaggaagaggctgacctcccggcagggccacggtgag
ccgaacccgacgtggatccccgcggggcaggacgcggccacccggctggccgagcgcatc
gacggctttcccgggggcacggtgggcgacgtgttcaacgtcccgatgaccgcgcacttc
ctgggcggctgcccgatcggcgacagcccggagaccggggtcatcgacccctaccaccgg
ctgtacggccacccgggcgtccacgtggtggacggctcggcggtcaccgcgaacctgggg
gtgaacccgtcgctgaccatcaccgcgcaggccgagcgcgcgatgtcgatgtggcccaac
aagggcgaggaggacacccgtccggagcagggcgagcggtaccggcgggtcgggccggtg
ttcccggcctccccggcggttccggccggcgccttcgccgagctgcggttcaccgccccg
ctcccgctctcggtggtggactcggaggcgccgtcagcggacgcggcggccgtcggcggg
acgaccggggccgctggggagaccggggccgatggggaggacgcacgaacgtga

DBGET integrated database retrieval system