KEGG   Nocardiopsis dassonvillei: Ndas_0578Help
Entry
Ndas_0578         CDS       T01248                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ndas_0578
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ndas_0578
Enzymes [BR:nda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ndas_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(719080..720660)
Genome map
AA seq 526 aa AA seqDB search
MPDTSPSLVPRPHTSAPGDAGGLTLTASTRVSADPDARGTLAWLQRELGAATGLPLATGD
EASAQIRLSVDPEAGLGREGYRLIVDAEGAIIVGNDPAGVFYGAQTLRQLLPADVYRDAP
LGGAEWALPAVSVTDAPRFRWRGVMLDVARHFVPKREVLRFIDLLAMHKLNVLHLHLTDD
QGWRVEIRRYPKLTEVGSWRTRSQVGAAKPPVFDERPHGGFFTQDDIREIVAYADARHVA
VVPEIDVPGHSQAAIHAYPELGECGRIPVGDQWGIFEEVLAVTDNVLEFYRNVLDELIEL
FPSTYVHVGGDECPKTQWRASASAQRRIKEEGLADEDELQSWFIRQLDEHLTSRGRRLVG
WDEILEGGLAPGATVMSWRGEEGGVAAARAGHDVVMSPTRTSYLDYRQSESGDEPVPVGT
LLRTEDVYLAEPVPPGLTEQEARHVLGAQVNVWTEHIDSPRRLDYMVFPRLSAFAEQVWS
SGERDYAEFEPRLRRHLERLDAAGVEYRPLEGPRPWHTRPGVVGWG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacacttccccctccctcgtcccccgtccccacacctcggctccgggagacgcc
gggggcctcacgctgaccgcctcgaccagggtgtccgccgaccccgacgcccggggcacg
ctcgcgtggctccagcgtgaactcggggcggccaccggcctccccctggccaccggcgac
gaggccagcgcccagatccggctgagcgtggaccccgaggcgggtctgggccgcgagggc
taccggctgatcgtggacgccgagggagccatcatcgtgggcaacgaccccgccggggtg
ttctacggtgcgcagaccctgcgccagctgctgcccgccgacgtctaccgggacgccccg
ctgggcggtgccgagtgggccctgcccgccgtgagcgtcaccgacgcgccccgttttcgc
tggcggggcgtgatgctggacgtggcccgtcacttcgtgcccaagcgcgaggtgctgcgg
ttcatcgacctgctggccatgcacaagctcaacgtcctgcacctgcacctgaccgacgac
caggggtggcgcgtggagatccgccgctacccgaagctgaccgaggtgggctcctggcgg
acccggagccaggtgggcgccgcgaagccgccggtgttcgacgagcgcccgcacggcggc
ttcttcacgcaggacgacatccgcgagatcgtcgcctacgccgacgcccggcacgtggcc
gtcgtccccgagatcgacgtgcccggccactcgcaggccgccatccacgcctaccccgag
ctgggcgagtgcggacggatcccggtcggcgaccagtgggggatcttcgaggaggtgctc
gcggtcaccgacaacgtcctggagttctaccgcaacgtcctggacgagctgatcgaactg
ttcccgagcacgtacgtgcacgtgggcggcgacgagtgccccaagacccagtggcgggcg
agcgcgtccgcgcagcggcggatcaaggaggaggggctggccgacgaggacgagctgcag
agctggttcatccgccagctggacgagcacctgacctcgcgcggccgccgcctggtcggc
tgggacgagatcctggagggagggctcgcgccgggggcgaccgtgatgtcgtggcgcggc
gaggaggggggtgtcgcggccgcgcgggccggtcacgacgtggtcatgagccccacccgc
acctcctacctggactaccggcagtcggagtccggggacgagcccgtcccggtgggcacg
ctgctgcggaccgaggacgtgtacctggccgagccggtccccccggggctgaccgagcag
gaggcccggcacgtgctgggcgcgcaggtgaacgtgtggaccgagcacatcgactcgccg
cgcaggctggactacatggtctttcccaggctgtcggccttcgccgagcaggtgtggtcg
tccggtgagcgcgactacgccgagttcgagccccggctgaggcggcacctggagcggctc
gacgcggccggggtggagtaccggccgctggaggggccgcgcccgtggcacacccgcccg
ggggtggtgggctgggggtga

DBGET integrated database retrieval system