KEGG   Nocardiopsis dassonvillei: Ndas_0656Help
Entry
Ndas_0656         CDS       T01248                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00520  Amino sugar and nucleotide sugar metabolism
nda01100  Metabolic pathways
nda01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ndas_0656
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Ndas_0656
Enzymes [BR:nda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ndas_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ADH66101
UniProt: D7AYB6
Position
1:complement(803587..805059)
Genome map
AA seq 490 aa AA seqDB search
MPYDPTLARLANATLLVPFESYQAPRWVLEGLADGISGVCLFHNNLDGPEQVTALNATLA
GVTDTPLISLDEEGGDVTRIGQAQGSDYPGNAALGAVDDPGLTRATLRSLGGRLAELGFN
LDLAPSVDVNVADDNPVIGTRSFGSDPELVARHAAAAVLGLQEAGVAACAKHFPGHGATS
QDSHHVLPRVEADADLLRRRELLPFRAAVEAGVRSILTAHIEMPGLGGDGPATLTPRILN
DLLRGELGFTGTVVSDAMDMQGVSGRIGIPEACVRAVAAGVDLLCLGRFVYADQVELIRA
ALVDAVREGRLPGERLEEAAGRNAELRTWIRAAQTRRSDAPAADGVGLVGARRAVRVDGD
LPPLADPYVVEVDAPSGMAVGEVPWGLSPWFPGTERVSPDVAHADRLAASARDRDLVVVV
RDAHRYPSAQALVNRLLSSHPDAVVVEMGLPIWRPDCGAHVSTYGAAHVNGLSAAELLGA
PVGAPSPGVN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgacccgaccctggcgcgtctggccaacgccacgctgctggtgcccttcgag
tcctaccaagccccgcgctgggtcctggagggtctggcggacgggatctccggtgtctgt
ctgttccacaacaacctggacggccccgagcaggtgaccgcgctcaacgcgaccctggcc
ggggtcaccgacaccccgctgatctccctggacgaggagggcggcgacgtcacccgcatc
ggccaggctcagggcagcgactaccccggcaacgcggccctgggcgccgtggacgacccc
ggcctgacccgcgccaccctgcgctccctgggcggacgcctggccgagctgggcttcaac
ctggacctggcgccctcggtggacgtcaacgtcgccgacgacaacccggtgatcggcacc
cgctccttcggctccgaccccgaactggtggcccggcacgcggcggccgccgtgctcggc
ctccaggaggcgggcgtggccgcgtgcgccaagcacttccccggccacggcgccacctcc
caggactcccaccacgtgctgccgcgcgtggaggccgacgccgacctcctgcgccgccgc
gagctgctgcccttccgcgcggccgtggaggcgggcgtccggtcgatcctgaccgcgcac
atcgagatgcccggcctgggcggcgacggccccgccacgctcaccccgcgcatcctcaac
gacctgctccgcggcgagctgggcttcaccggcaccgtggtcagcgacgccatggacatg
cagggcgtcagcggccgtatcggcatccccgaggcctgcgtgcgcgcggtggccgccggg
gtggacctgctgtgcctgggccggttcgtctacgccgaccaggtcgagctgatccgcgcc
gcgctggtggacgcggtccgggagggccgcctgcccggggagcgcctggaggaggccgcc
gggcgcaacgccgagctgcggacctggatccgcgcggcccagacccggcgctcggacgcg
cccgcggccgacggggtgggcctggtcggggcccgccgcgcggtgcgcgtggacggcgac
ctgccgccgctggcggacccctacgtggtggaggtggacgccccctccggcatggcggtg
ggcgaggtcccctggggcctgtccccctggtttccgggcaccgagcgggtctcccccgac
gtcgcgcacgccgaccggctggccgccagcgcccgggaccgcgacctggtcgtggtggtg
cgggacgcgcaccgctacccctccgcccaggcgctcgtcaaccgcctgctcagctcccac
cccgacgccgtggtggtggagatggggctgcccatctggcggcccgactgcggcgcgcac
gtgagcacctacggcgccgcgcacgtgaacgggctgagcgcggcggagctgctgggggca
ccggtgggcgccccctcccccggcgtgaactga

DBGET integrated database retrieval system