KEGG   Nocardiopsis dassonvillei: Ndas_0683Help
Entry
Ndas_0683         CDS       T01248                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00620  Pyruvate metabolism
nda00630  Glyoxylate and dicarboxylate metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01200  Carbon metabolism
Module
nda_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ndas_0683
   00630 Glyoxylate and dicarboxylate metabolism
    Ndas_0683
Enzymes [BR:nda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ndas_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADH66128
UniProt: D7AYE3
Position
1:complement(837523..839127)
Genome map
AA seq 534 aa AA seqDB search
MGATHGVEITGPLHERFDEILTEDALALVAELHRAFEARRQELLEARAARQEQISAGADL
DFLPETKHIREDDSWRVAPPAPGITDRRVEITGPTDRKMTINALNSGAKVWLADFEDANT
PLWENMIGGQLNLRDALDRTIDFTSPQGKTYALKEDGELATVVVRPRGWHLDEKHVLVDG
QRVSGGLLDFALYFFHCAQRQIDKGRGPYFYLPKMQSHLEARLWNDVFVLAQERLGIPRG
TIRATCLIETIPAAFEMEEILYELREHSAGLNAGRWDYLFSIIKTHRTRGRRFLLPERNA
VTMTAPMMRAYTELLVKTCHKRGAHAIGGMAAFIPSRRDEEVNRTAFAKVRDDKSRESGD
GFDGSWVAHPGLVPVAMEVFDGVLGERPHQIDKQRPEVEVSAEDLLAVDRTPGGVTLAGL
RGNVNVALQYLATWMGGNGAVAIHNLMEDAATAEISRSQVWQWLHNDITLDNGPKVTADL
VRGIIDEELAAIREQLGADFDEDLYQQAGELFTEVALADEYVDFLTLPAYERMP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccacgcacggggtcgagatcaccggccccctccacgaacggttcgacgagatc
ctcaccgaggacgccctcgccctcgtcgccgagctgcaccgcgccttcgaggcgcgccgc
caggagctcctcgaagcccgggcggccaggcaggagcagatctcggccggggccgacctc
gacttcctccccgagaccaagcacatccgtgaggacgacagctggcgggtcgcccctccc
gccccgggcatcacggaccgccgcgtggagatcaccggccccaccgaccgcaagatgacc
atcaacgcgctcaactccggcgccaaggtgtggctggccgacttcgaggacgccaacacc
ccgctgtgggagaacatgatcgggggccagctcaacctgcgcgacgccctcgaccgcacc
atcgacttcacctccccccagggcaagacctacgccctgaaggaggacggcgagctcgcc
accgtcgtcgtgcgcccgcgcggctggcacctggacgagaagcacgtcctcgtggacggc
cagcgcgtcagcggcggcctgctggacttcgccctctacttcttccactgcgcccagcgc
cagatcgacaagggcaggggaccctacttctacctgcccaagatgcagagccacctcgag
gcgcgcctgtggaacgacgtcttcgtcctggcccaggagcgcctgggcatcccgcgcggc
accatccgcgcgacctgcctcatcgagaccatcccggccgcgttcgagatggaggagatc
ctctacgagctgcgcgagcactccgcgggcctcaacgcgggccgctgggactacctgttc
agcatcatcaagacgcaccgcacccgcggccgcaggttcctgctgcccgagcgcaacgcc
gtcacgatgaccgcgccgatgatgcgcgcctacaccgaactgctggtcaagacctgccac
aagcgcggcgcccacgccatcggcggcatggcggccttcatcccctcccgcagggacgag
gaggtcaacaggaccgccttcgccaaggtccgcgacgacaagtcccgcgagtccggcgac
ggcttcgacggctcctgggtcgcccacccgggtctggtcccggtggccatggaggtcttc
gacggcgtcctgggcgagcgcccccaccagatcgacaagcagcgccccgaggtcgaggtc
tcggccgaggacctgctggccgtggacaggaccccgggcggcgtcaccctcgcgggcctg
cgcggcaacgtcaacgtcgccctgcagtacctggcgacgtggatgggcggcaacggcgcg
gtggccatccacaacctcatggaggacgccgcgaccgccgagatctcgcgctcccaggtc
tggcagtggctgcacaacgacatcacgctcgacaacggccccaaggtcaccgccgacctg
gtccgggggatcatcgacgaggagctcgccgccatccgcgaacagctgggcgcggacttc
gacgaggacctgtaccagcaggccggcgagctgttcaccgaggtggccctggccgacgag
tacgtcgacttcctgacgctgcccgcctacgagcgcatgccgtag

DBGET integrated database retrieval system