KEGG   Nocardiopsis dassonvillei: Ndas_0683Help
Entry
Ndas_0683         CDS       T01248                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_0683
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ndas_0683
   00630 Glyoxylate and dicarboxylate metabolism
    Ndas_0683
Enzymes [BR:nda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ndas_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(837523..839127)
Genome map
AA seq 534 aa AA seqDB search
MGATHGVEITGPLHERFDEILTEDALALVAELHRAFEARRQELLEARAARQEQISAGADL
DFLPETKHIREDDSWRVAPPAPGITDRRVEITGPTDRKMTINALNSGAKVWLADFEDANT
PLWENMIGGQLNLRDALDRTIDFTSPQGKTYALKEDGELATVVVRPRGWHLDEKHVLVDG
QRVSGGLLDFALYFFHCAQRQIDKGRGPYFYLPKMQSHLEARLWNDVFVLAQERLGIPRG
TIRATCLIETIPAAFEMEEILYELREHSAGLNAGRWDYLFSIIKTHRTRGRRFLLPERNA
VTMTAPMMRAYTELLVKTCHKRGAHAIGGMAAFIPSRRDEEVNRTAFAKVRDDKSRESGD
GFDGSWVAHPGLVPVAMEVFDGVLGERPHQIDKQRPEVEVSAEDLLAVDRTPGGVTLAGL
RGNVNVALQYLATWMGGNGAVAIHNLMEDAATAEISRSQVWQWLHNDITLDNGPKVTADL
VRGIIDEELAAIREQLGADFDEDLYQQAGELFTEVALADEYVDFLTLPAYERMP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccacgcacggggtcgagatcaccggccccctccacgaacggttcgacgagatc
ctcaccgaggacgccctcgccctcgtcgccgagctgcaccgcgccttcgaggcgcgccgc
caggagctcctcgaagcccgggcggccaggcaggagcagatctcggccggggccgacctc
gacttcctccccgagaccaagcacatccgtgaggacgacagctggcgggtcgcccctccc
gccccgggcatcacggaccgccgcgtggagatcaccggccccaccgaccgcaagatgacc
atcaacgcgctcaactccggcgccaaggtgtggctggccgacttcgaggacgccaacacc
ccgctgtgggagaacatgatcgggggccagctcaacctgcgcgacgccctcgaccgcacc
atcgacttcacctccccccagggcaagacctacgccctgaaggaggacggcgagctcgcc
accgtcgtcgtgcgcccgcgcggctggcacctggacgagaagcacgtcctcgtggacggc
cagcgcgtcagcggcggcctgctggacttcgccctctacttcttccactgcgcccagcgc
cagatcgacaagggcaggggaccctacttctacctgcccaagatgcagagccacctcgag
gcgcgcctgtggaacgacgtcttcgtcctggcccaggagcgcctgggcatcccgcgcggc
accatccgcgcgacctgcctcatcgagaccatcccggccgcgttcgagatggaggagatc
ctctacgagctgcgcgagcactccgcgggcctcaacgcgggccgctgggactacctgttc
agcatcatcaagacgcaccgcacccgcggccgcaggttcctgctgcccgagcgcaacgcc
gtcacgatgaccgcgccgatgatgcgcgcctacaccgaactgctggtcaagacctgccac
aagcgcggcgcccacgccatcggcggcatggcggccttcatcccctcccgcagggacgag
gaggtcaacaggaccgccttcgccaaggtccgcgacgacaagtcccgcgagtccggcgac
ggcttcgacggctcctgggtcgcccacccgggtctggtcccggtggccatggaggtcttc
gacggcgtcctgggcgagcgcccccaccagatcgacaagcagcgccccgaggtcgaggtc
tcggccgaggacctgctggccgtggacaggaccccgggcggcgtcaccctcgcgggcctg
cgcggcaacgtcaacgtcgccctgcagtacctggcgacgtggatgggcggcaacggcgcg
gtggccatccacaacctcatggaggacgccgcgaccgccgagatctcgcgctcccaggtc
tggcagtggctgcacaacgacatcacgctcgacaacggccccaaggtcaccgccgacctg
gtccgggggatcatcgacgaggagctcgccgccatccgcgaacagctgggcgcggacttc
gacgaggacctgtaccagcaggccggcgagctgttcaccgaggtggccctggccgacgag
tacgtcgacttcctgacgctgcccgcctacgagcgcatgccgtag

DBGET integrated database retrieval system