KEGG   Nocardiopsis dassonvillei: Ndas_0718Help
Entry
Ndas_0718         CDS       T01248                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nda00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(881665..882561)
Genome map
AA seq 298 aa AA seqDB search
MGIRLGDNQYGKAEVRLVHVNRDTDVHRIKDVNVTSQLRGELETVHTLGDNSTCLPTDTQ
KNTVYAKAREWGGVGAVEDFALRLARHFVDEHEYVHGARQEVHEYSWERIQTSSGPHDHA
FSRKGAETRTTVVTKTGDREWVVSGFEGLSVLKSTGSEFHGYPKTRYTTLPETTDRILAT
DVTARWRYVGVEHDFDSTYSSVRALCLDAFARTHSLALQQTLYEMGRAVLEAHPEIAEIR
FSMPNNHHFLVDLSPFGLDNPNEVFFAADRPYGKIEATVERDDAPGPGDAWKTVPGFV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggcatccgactcggagacaaccagtacggcaaggccgaggtccgcctcgtccacgtc
aaccgcgacaccgacgtccaccggatcaaggacgtcaacgtcacctcccagctgcgcgga
gagctggagacggtgcacaccctcggcgacaacagcacctgcctgccgaccgacacccag
aagaacaccgtctacgccaaggcccgcgagtggggcggcgtcggcgccgtcgaggacttc
gccctgcgtctggcccgccacttcgtggacgagcacgagtacgtgcacggggcccgccag
gaggtgcacgagtactcctgggagcggatccagacctcctccggcccgcacgaccacgcg
ttctcgcgcaagggcgccgagacccgcaccaccgtcgtcaccaagacgggcgaccgggag
tgggtggtctccggcttcgagggcctgtccgtgctcaagtccaccggctcggagttccac
ggctaccccaagaccaggtacacgacgctgcccgagaccaccgaccggatcctggccacc
gacgtcaccgcccgctggcgctacgtgggcgtggagcacgacttcgacagcacctactcc
tcggtccgcgccctgtgcctggacgccttcgcccggacccacagcctggcgctgcagcag
accctctacgagatgggcagggccgtcctggaggcgcacccggagatcgccgagatccgc
ttctccatgcccaacaaccaccacttcctggtggacctgtccccgttcggcctggacaac
ccgaacgaggtcttcttcgccgccgaccgcccctacggcaagatcgaggccaccgtggag
cgcgacgacgcccccgggcccggcgacgcctggaagaccgtccccggcttcgtctag

DBGET integrated database retrieval system