KEGG   Nocardiopsis dassonvillei: Ndas_0838Help
Entry
Ndas_0838         CDS       T01248                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nda00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ndas_0838
Enzymes [BR:nda01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Ndas_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1029540..1030160
Genome map
AA seq 206 aa AA seqDB search
MIAFLTGRVAARGAGTAVIDVGGVGMTVQCTPSALSRLHVGETGTVATSLVVREESLTLF
GFADDDEKHLFEQLQTASGVGPRLALAMLSVHSPSSLRHAVSTEDTTALTRVPGIGKKGA
QRIVLELRGKLDAPVLTDGTLPGSEAAGTGSEPNGAWRGQVVSGLVNLGWSAKDAEAAAS
AVAAEAEHTDDVAVLLRSALRRLSRA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgttcctcaccggccgggtggccgcacgcggcgcgggcaccgccgtcatcgac
gtcggcggggtcggcatgaccgtgcagtgcacgccctccgcgctctcgcgcctgcacgtg
ggcgagaccgggaccgtggccaccagcctcgtcgtgcgcgaggagtccctgaccctgttc
gggttcgccgacgacgacgagaagcacctgttcgagcagctccagaccgcctccggtgtc
ggtccccgcctggccctggccatgctctccgtccacagcccctccagcctgcgccacgcc
gtgtccaccgaggacaccaccgccctcacccgggtgcccggcatcggcaagaagggcgcc
cagcgcatcgtcctggaactgcgcggcaagctcgacgcgcccgtgctcaccgacggcacc
ctgcccgggtccgaggccgccgggaccggcagcgagcccaacggcgcctggcgcggacag
gtggtctccggcctggtcaacctcggctggtcggccaaggacgccgaggccgccgcctcc
gccgtggcggccgaggccgagcacaccgacgacgtcgccgtcctgctgcgcagcgccctg
cgcaggctcagccgggcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system