KEGG   Nocardiopsis dassonvillei: Ndas_0892Help
Entry
Ndas_0892         CDS       T01248                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ndas_0892
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ndas_0892
Enzymes [BR:nda01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ndas_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1091747..1093414
Genome map
AA seq 555 aa AA seqDB search
MRPEHTPLRPLSALAALLGPDASLLRPDLGADRPPEVPDREVHVRGITHDSRQVGPGDLY
AALPGTRAHGADFAGQAAEAGAAAVLTDGDGAERAAATGLPVIVVPDVRAVLGTAASWVF
KDPAQDLLLIGTTGTSGKTTVTYLVESGLRHAGMRTGLVGTVEMRVGDERVVSSLTTPEA
TDLHGLFALMRERGVSAAAMEVSSHALALSRVGGTRYDVAVFTNLSQDHLDFHSDLRDYF
DAKARLFTPEYCDIAVVNADDRFGRALVDMVQADGRVPVTTFAVDGYTDADPATAMEADW
RAVDVRLGAMGSAFRIVGPGGMEANASVALPGPFNVSNAMAAIVGLVEAGLPLETAIAGV
AAAPGVPGRMEPVVANAVPHAFQDFTALVDYSHKPGAIEAVLTALRATTEGGLTMVVGCG
GDRDRAKRPLMGEAAARLSDQLVITNDNPRTEDPVSIAASMLEGVAKVPEEHRARVTVEF
DRAEAIRLAVERARPGDVVVVAGKGHETGQYVKGEVLPFDDREVLRAAIEDHLGMSARER
LGVALQDIHRVPDQG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgacctgaacacacgccacttcgtccactgtccgccctcgcagcgctgctcgggccg
gacgcctccctcctgcgcccggacctgggcgcggaccgaccccccgaggtgccggacagg
gaggtgcacgtccgcggcatcacccacgactcccgccaggtggggcccggagacctgtac
gccgccctgcccgggacccgcgcgcacggcgccgacttcgccgggcaggccgccgaggcg
ggcgccgccgccgtcctcaccgacggggacggggccgagcgggccgccgccaccgggctg
cccgtcatcgtggtccccgacgtgcgcgccgtgctgggcacggcggcctcgtgggtcttc
aaggacccggcgcaggacctgctgctgatcggcaccaccggcaccagcggcaagaccacc
gtcacgtacctggtcgagtcgggcctgcgccacgccggaatgcgcaccggcctcgtcggc
accgtggagatgcgcgtgggcgacgaacgcgtcgtctcctcgctcaccacgcccgaggcc
accgacctgcacggcctgttcgccctcatgcgcgaacgcggcgtctccgccgccgccatg
gaggtctccagccacgccctggccctgagccgggtcggtggcacccgctacgacgtcgcg
gtcttcaccaacctgtcccaggaccacctggacttccactccgacctgcgcgactacttc
gacgccaaggcccgcctgttcacccccgagtactgcgacatcgcggtggtcaacgccgac
gaccgcttcggccgcgcgctcgtggacatggtgcaggccgacggccgcgtccccgtcacc
accttcgccgtggacggctacaccgacgccgaccccgccaccgccatggaggccgactgg
cgggccgtggacgtgcgtctgggcgccatggggagcgccttccgcatcgtgggccccggc
ggcatggaggccaacgcctccgtcgccctgcccggacccttcaacgtctccaacgcgatg
gccgccatcgtcggtctggtcgaggcggggctgccgctggagaccgcgatcgcgggtgtg
gccgccgccccgggcgtgcccgggcgcatggagccggtcgtggccaacgccgtgccccac
gccttccaggacttcaccgcgctcgtggactactcgcacaagcccggcgccatcgaggcc
gtcctgaccgccctgcgcgccaccaccgagggcgggctgaccatggtggtcggctgcgga
ggcgaccgcgaccgcgccaaacgcccgctcatgggcgaagccgccgcgcgcctgtccgac
cagctggtcatcaccaacgacaacccgcgcaccgaggaccccgtgagcatcgccgcgtcg
atgctcgaaggggtcgccaaggtgcccgaggagcaccgcgcccgggtcaccgtggagttc
gaccgggccgaggccatccgcctggccgtcgagcgcgcccgtcccggcgatgtggtggtt
gtcgccgggaagggtcacgagaccggtcagtacgtcaagggtgaggtgctgcccttcgac
gaccgcgaggtgctgcgcgcggccatcgaggaccacctcggcatgagcgcccgcgagcgg
ctgggggtcgccctccaggacatccaccgggttcctgaccagggctga

DBGET integrated database retrieval system