KEGG   Nocardiopsis dassonvillei: Ndas_0943Help
Entry
Ndas_0943         CDS       T01248                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_0943
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ndas_0943
  Amino acid metabolism
   00310 Lysine degradation
    Ndas_0943
Enzymes [BR:nda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ndas_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1158017..1159819)
Genome map
AA seq 600 aa AA seqDB search
MPTSVSMPALGESVTEGTVTQWLKNVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVLTKIL
VDEDETVEIGAEIAVIGGEGEGADDEGGAEPAAEESAQEPEETEKPEEGAAEEPEPEPAP
EPESGAGARASSSDRGPTTSVTMPALGESVTEGTVTQWLKSVGDTVEVDEPLLEVSTDKV
DTEIPSPVAGVLTKILVDEDETVEIGAEIAVIGGTGDEPPAVSEGAAPAEAEPKAEPVSE
PEPAEAEPAAPAPKAEAEPEPAADRDKDGESPSVDIGTLSGTGRASGTDAGTEAYVTPLV
RKLASEHGVNLSRVKGTGVGGRVRKQDVLKAAEEQKADAARAAAPAPSSAPRKGATDTSL
RGRTEKLTRLRLSIADRMVESLHVSATTTQVIEVDVTKIARLREHSAERFAEREDVRLDF
FPFFALAAVEALRSHPKLNAVIDSDKQEVTYHDVENLGVSVDTERGLLAPVVKDAGKLGL
GELARRLKDLTERAHTGQLGPDELGGGTFTIAETGCTGALFGTPIINQPQVAILGTGAVV
KRPVVVEDTAMGDEVIAVRSMVYLSLAHDHRLIDSADAGRFLQSVKARLEEGAFEDDLGL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgccgacttccgtttccatgcccgccctgggtgagagcgtcaccgagggcaccgtcacc
cagtggctgaagaacgtgggcgacaccgtcgaggtggacgaaccgctcctggaggtctcc
accgacaaggtggacaccgagattccctcacccgtcgcgggcgtactcaccaagatcctc
gtcgacgaggacgagaccgtggagatcggcgcggagatcgccgtcatcggcggtgagggc
gagggcgccgacgacgagggcggcgccgagcccgcggccgaggagtccgcgcaggagccc
gaggagaccgagaagcccgaggagggggccgccgaggagcccgagccggagcccgccccc
gagcccgagtccggggccggcgcgcgggcctcgtcctccgaccggggcccgaccacgtcg
gtgaccatgcccgccctgggtgagagcgtcaccgagggcaccgtcacccagtggctcaag
agcgtgggcgacaccgtcgaggtggacgaaccgctcctggaggtctccaccgacaaggtg
gacaccgagattccctcacccgtcgcgggcgtactcaccaagatcctcgtcgacgaggac
gagaccgtggagatcggcgcggagatcgccgtcatcggcggcaccggggacgagcccccg
gccgtctccgagggcgcggccccggccgaggccgagcccaaggccgaaccggtgtcggag
cccgagcccgccgaggccgagcccgccgcgcccgccccgaaggccgaggccgagcccgag
cccgccgcggaccgggacaaggacggcgagagcccgtccgtggacatcggcaccctcagc
ggcaccggccgcgcctcgggtaccgacgccgggaccgaggcgtacgtgaccccgctggtg
cgcaagctcgcctccgagcacggcgtgaacctcagccgtgtcaagggcaccggcgtgggc
ggccgcgtccgcaagcaggacgtgctcaaggccgccgaggagcagaaggccgacgccgcg
cgcgccgccgcccccgcgccgtcctcggccccgcgcaagggggccaccgacacctccctg
cgcggccgtaccgagaagctcacccgcctgcgcctgtccatcgcggaccggatggtggag
tcgctgcacgtctcggccacgaccacgcaggtcatcgaggtggacgtcaccaagatcgcc
cgcctgcgcgagcactccgccgagcgcttcgccgagcgcgaggacgtgcggctggacttc
ttcccgttcttcgcgctggccgcggtggaggccctgcgctcccaccccaagctcaacgcc
gtgatcgacagcgacaagcaggaggtgacctaccacgacgtggagaacctcggcgtctcg
gtggacaccgagcgcggtctgctggcccccgtggtcaaggacgcgggcaagctgggcctg
ggtgagctggcgcgcaggctcaaggacctgaccgagcgcgcccacaccggccagctgggc
ccggacgagctgggcggcggcacgttcaccatcgccgagaccggctgcaccggcgcgctg
ttcggcacgccgatcatcaaccagccgcaggtggccatcctgggcaccggcgcggtcgtc
aagcgccccgtcgtggtcgaggacaccgccatgggcgacgaggtgatcgcggtccgctcg
atggtgtacctgtcgctggcccacgaccaccgcctgatcgacagcgccgacgccgggcgc
ttcctccagagcgtgaaggcgcgtctggaggagggcgccttcgaggacgacctgggcctg
tag

DBGET integrated database retrieval system