KEGG   Nocardiopsis dassonvillei: Ndas_1245Help
Entry
Ndas_1245         CDS       T01248                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_1245
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_1245
   00620 Pyruvate metabolism
    Ndas_1245
   00640 Propanoate metabolism
    Ndas_1245
  Energy metabolism
   00680 Methane metabolism
    Ndas_1245
Enzymes [BR:nda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ndas_1245
Lipid biosynthesis proteins [BR:nda01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ndas_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1546613..1548259
Genome map
AA seq 548 aa AA seqDB search
MTTTGTEAAAFETPGPDALAEGERLYRRLRSEQRWEVPERYNMAVDVADHHPGDRVALVF
EDHTGHRDEVTWDRVRDRAARVAAHLHALGVREGDRVAVLLPQRPDTPATYLGVLRTGAV
LVTMSLLWADDPIAYRLADSGSTVLITEDAALERAAGAVRAARASHGLDADVRVVSVDDP
AVAAREPRHEAADTAADDPALIFYTSGTTGAAKGIVHAHRTLLGHNEFRYCHDLRPGDVF
YGAGDWAWSMAKLMGPLRAGATHLVHRPRAGFDPEGLLAAMARNRVTTALVNPTLLRKLR
AGVPDAGRRHPQSLRVVCCSNEPLTTDLITWFREQFGVTPFDYYGSTESYPLLGNMPGIP
VKPGSVGRPLPGWDVVLLDAQDREVPDGEPGEICLRARSNPQFPLGYWNRPEASAETFGG
TWYRTKDQATRDADGYFWFLGRTDDVIKTSGYRVGPYEVEAALREHPAVADAGVVGLPDP
LRGQVVKAWIELADGYEPSEELADRIRAFAREHHSLFAYPRLIAFEERLPRSATGKVQRA
ELRRRDTA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccggaaccgaggccgccgccttcgagacccccggcccggacgcactcgcc
gagggggagcgcctctaccgccgactgcgctccgagcagcgctgggaggtgcccgagcgg
tacaacatggccgtcgacgtcgccgaccaccaccccggggaccgggtcgccctcgtcttc
gaggaccacaccgggcaccgcgacgaggtcacctgggaccgcgtccgcgaccgggcggcc
cgcgtcgccgcccacctgcacgccctgggcgtgcgcgagggcgaccgcgtcgcggtcctg
ctgccccagcgccccgacacccccgccacctacctgggcgtgctgcgcaccggtgccgtc
ctggtcaccatgtccctgctgtgggccgacgaccccatcgcctaccggctcgccgactcc
ggcagcaccgtcctgatcaccgaggacgccgccctggaacgcgccgcgggagccgtccgc
gccgcccgcgcctcccacgggctcgacgccgacgtccgcgtcgtgagcgtggacgacccg
gccgtggccgcccgcgagccccgccacgaggccgccgacaccgccgccgacgaccccgcg
ctcatcttctacacctcggggaccaccggcgcggccaagggcatcgtgcacgcccaccgc
accctgctgggccacaacgagttccgctactgccacgacctgcgccccggcgacgtgttc
tacggggcgggcgactgggcctggtccatggccaagctcatgggcccgctgcgagccggg
gccacccacctggtccaccgcccccgcgcgggcttcgatcccgaggggctgctcgccgcg
atggcgcgcaaccgggtcaccaccgccctggtcaaccccaccctgctgcgcaagctccgc
gccggggtgcccgacgccggacgccgccacccccagtccctgcgcgtggtgtgctgctcc
aacgagccgctgaccaccgacctcatcacctggttccgggagcagttcggcgtcaccccg
ttcgactactacgggtccaccgagtcctaccccctgctcgggaacatgcccggaatcccg
gtcaagcccggctcggtgggccgcccgctgcccggctgggacgtcgtcctgctggacgca
caggaccgcgaggtccccgacggggaacccggcgagatctgcctgcgcgcccgcagcaac
ccgcagttcccgctgggctactggaaccggcccgaggcctccgccgagaccttcggcggc
acctggtaccgcaccaaggaccaggccacccgcgacgccgacggctacttctggttcctg
ggccgcaccgacgacgtcatcaagacctccggctaccgggtcggaccctacgaggtcgag
gcggccctgcgcgagcacccggccgtcgccgacgccggggtcgtgggcctgcccgacccg
ctgcgcggacaggtcgtcaaggcatggatcgaactggccgacgggtacgagccgagcgag
gagctcgccgaccggatccgcgccttcgcccgcgagcaccactccctcttcgcctacccg
cgcctgatcgccttcgaggagcgcctgccccgctccgccaccggcaaggtccaacgcgcc
gagctgcgccgacgcgacacggcctga

DBGET integrated database retrieval system