KEGG   Nocardiopsis dassonvillei: Ndas_1310Help
Entry
Ndas_1310         CDS       T01248                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nda  Nocardiopsis dassonvillei
Brite
Enzymes [BR:nda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ndas_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1615902..1617161
Genome map
AA seq 419 aa AA seqDB search
MTTSDTSTSTPGTDRIDELRERMIIRLRAVNALHSEPVTRAVRTVPRHAFAPEFPLEEVY
DPETVLRTRFADDGTATSSVSATWVQTLMLERARLRPGMRVLEVGSGGYNAALAAEVVGP
AGSVTSLDIDPAVIDRARTHLTQAGYADRVELVVGDAEHGHPSSAPYDRIIVTAAATDLP
PTWTHQLVDGGRLVLPLGVRGFQRVYAFTRHGALLLGETGNHAGFVPMQGLGASASTTVP
VTDTVELTTDADPTPAPEALSAVFALPAQEQFTGVRIAGMEPFSALQMWMATGLPHFATL
TGTADDFRYRPMTHALIPAMWDGTSLAYLLLPAVPDASATYEFVACGHGPDAADVVATMA
DHVRRWDRDHRGGPGPRFLAHPDFPPGDGIIRTRHTRLLALWDQAEEDHGLDWPADPGR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacctccgacacctccacctctactccgggtaccgaccgtattgatgagctgcgc
gaacgcatgatcattcgcctgcgagccgtcaacgccctgcactccgaaccagtcaccaga
gcggtgcgcaccgtgccccgccacgccttcgctccggagttccctctggaggaggtctac
gacccggagacggtgctgcgcactcgcttcgccgacgacggcaccgccaccagctcggtc
tcagcgacctgggtgcagaccctgatgctggaacgcgcccgactccgccccggcatgcgg
gtgctggaggtcgggtcgggcggctacaacgccgcactggccgctgaggtcgtcggaccc
gccggatcggtgacctccctcgacatcgaccccgcggtcatcgaccgcgcccgcacccac
ctgacccaggccggatacgccgaccgggtggagctggtcgtcggcgacgccgaacacggc
caccccagcagcgcaccctacgaccggatcatcgtcacggccgccgccaccgacctgcct
ccgacctggactcatcagctcgtcgacggtggacgcctcgtgctcccgttgggggtgcgg
ggtttccagcgcgtctacgccttcactcgccacggcgcactgctgctgggcgagaccggc
aaccacgcggggttcgtccccatgcagggcctgggcgcttccgcctccaccaccgtgccg
gtcaccgacacggtcgagctgaccaccgacgccgaccctacgcccgcccccgaagccctg
tccgcagtgttcgctctccccgctcaggagcagttcaccggggtccgtatcgctggcatg
gaacccttcagcgccctgcagatgtggatggccaccgggctaccccacttcgccaccctg
accggcaccgccgacgatttccgctaccgacctatgacccatgccctgatcccggcgatg
tgggacgggacctcactggcctacctgctgctccccgcggtacccgatgcctccgccaca
tacgagttcgtggcctgcggtcacgggcccgacgccgccgacgtagtcgccaccatggcc
gaccacgtccgtcgctgggaccgcgaccaccgcggcgggcccggtccccggttcctggcc
catcctgacttcccacctggggacgggatcattcgcacccgccacacccgtctgctggcc
ctgtgggaccaggccgaggaggaccacggtttggactggcccgccgaccccggcaggtga

DBGET integrated database retrieval system