KEGG   Nocardiopsis dassonvillei: Ndas_1429Help
Entry
Ndas_1429         CDS       T01248                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_1429
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ndas_1429
Enzymes [BR:nda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ndas_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1749655..1750953)
Genome map
AA seq 432 aa AA seqDB search
MGTSARRQEASAALQRDWETNPRWAGIERTYSADDVVKLRGSVTEEHTLARRGAERLWDL
LRTEDYVNTLGALTGNQAVQQVRAGLKAIYLSGWQVAADANLSGNTYPDQSLYPANSVPA
VVRRINNALMRADQITWAEGDDSAPEWLAPIVADAEAGFGGVLNAYELMRGMIASGAAGV
HWEDQLASEKKCGHLGGKVLIPTGQHVKTLNAARLAADVAGVPSLVIARTDAQAATLITS
DVDERDQPFITGERTAEGFYRFRNGVEACVARGLAYAPHSDLLWMETATPDLEVARDFAE
RIKAEYPDQMLAYNCSPSFNWKRHLDDATIAKFQRELGHMGYKFQFITLAGFHSLNYSMF
NLAKGYAQNGMTSYVELQEAEFAAESQGYTATRHQREVGTGYFDSISTTISPEASTTALT
GSTEEDQFSAAH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccagcgctcgacgacaggaagccagcgccgcactccagcgcgactgggagacc
aacccccggtgggccggtatcgagcgcacctactccgccgacgacgtggtcaagctccgc
ggttcggtcaccgaggagcacaccctggcccgccgcggcgcggagcgcctgtgggacctg
ctccgcaccgaggactacgtcaacaccctcggcgccctcaccggcaaccaggcggtccag
caggtccgtgccgggctgaaggccatctacctctccggctggcaggtcgcggccgacgcc
aacctctcgggcaacacctaccccgaccagagcctgtacccggccaactcggtcccggcc
gtggtccgccgcatcaacaacgcgctgatgcgcgccgaccagatcacctgggccgagggc
gacgacagcgcgcccgagtggctcgccccgatcgtggccgacgccgaggccgggttcggc
ggcgtcctcaacgcctacgagctgatgcggggcatgatcgcctccggcgcggcgggcgtg
cactgggaggaccagctggcctccgagaagaagtgcggccacctgggcggcaaggtcctc
atccccaccgggcagcacgtcaagacgctcaacgccgcccgcctggccgcggacgtcgcc
ggtgtcccgtccctggtcatcgcgcggaccgacgcccaggccgcgaccctgatcaccagc
gacgtcgacgagcgcgaccagcccttcatcacgggcgagcgcaccgccgagggcttctac
cgcttccgcaacggcgtcgaggcctgcgtggcgcgcggcctggcctacgccccgcactcg
gacctgctgtggatggagaccgccacccccgacctggaggtggcccgcgacttcgccgag
cggatcaaggccgagtacccggaccagatgctggcctacaactgctcgccgtccttcaac
tggaagcgccacctggacgacgcgaccatcgccaagttccagcgcgagctgggccacatg
ggctacaagttccagttcatcaccctggcgggcttccactcgctcaactactcgatgttc
aacctggccaagggctacgcccagaacgggatgacctcgtacgtcgagctccaggaggcc
gagttcgcggccgagtcgcagggctacaccgccacccgccaccagcgcgaggtcggcacc
ggctacttcgactccatcagcacgaccatctcccccgaggccagcaccacggctctcacc
ggctccaccgaggaagaccagttctcagcggctcactga

DBGET integrated database retrieval system