KEGG   Nocardiopsis dassonvillei: Ndas_2119Help
Entry
Ndas_2119         CDS       T01248                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ndas_2119
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ndas_2119
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ndas_2119
Enzymes [BR:nda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ndas_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2537482..2539098)
Genome map
AA seq 538 aa AA seqDB search
MPGTPRTPAPLPVPDPTVSSTTRRQALVGGAATLGAVALGASWSPGVRADASVRADAPAR
SGGIGEPFTLGVASGDPFHSSVVLWTRLAPNPFAEDGLGGMPDRRVEVEWQVSREEGFGL
LSASGTVETGPDAAHSVHVEAQGLRPGTEYFYRFRVGNEISQVGRTRTAPPPGIRTDRFS
FAFASCQSYTAGHYNAHAHLAEEDLDLVAFLGDYIYETGGQGSLGRGHLPDREVRTLAEY
RVRHAQYKSDANLQAAHAAFPWAVVFDDHELENNWADDRSNGEDVPPEEFLRRRAQALKA
YHEHMPLRFAQTPVGPDMQLYRRLAFGDLVDMHLLDTRQYRDPQVSDAERGDPSRTLLGA
RQKQWLREGLSSSRARWNVLAQQVFFSQRDFAEGGATDFSNDAWDNYLVDRDEVRDQLAR
TRNGVVITGDVHANYVCDVKADFDAPESPTVATELVGTSVTSGGDGTEQAPGDEVQLREN
PHIRFVNRKRGYVRNVVTPTEWTADYRVVDHVSEPGSPIRDRARFVIEDGVAGVRMEG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgccgggaacccctcgcacccccgccccccttcccgtccccgacccgaccgtcagcagc
accacacggcgccaggccctggtcggcggcgcggccactctgggcgccgtcgcgctgggc
gcctcctggagtcccggcgtgcgggccgacgcctccgtccgcgccgacgcccccgcccgg
tcgggcggcatcggtgagcccttcaccctgggcgtcgcctccggcgaccccttccacagc
agcgtcgtgctctggacccgtctggcccccaaccccttcgccgaggacggactgggcggc
atgcccgaccggcgggtggaggtcgagtggcaggtctcacgggaggagggcttcggtctg
ctctccgcctccggaaccgtggagacgggccccgacgccgcccactcggtgcacgtggag
gcgcaggggctgcggcccggcaccgagtacttctaccggttccgcgtgggcaacgagatc
agccaggtcggccgtaccaggaccgcccctccccccgggatccgcacggaccggttctcc
ttcgcgttcgccagctgccagagctacaccgccgggcactacaacgcccacgcgcacctg
gccgaggaggacctggacctggtcgcgttcctgggcgactacatctacgagacgggcgga
caggggagcctgggccggggccacctccccgaccgggaggtccgcaccctggccgagtac
cgcgtgcggcacgcccagtacaagagcgacgccaacctccaggccgcgcacgccgccttc
ccgtgggcggtggtcttcgacgaccacgagctggagaacaactgggccgacgaccgctcc
aacggcgaggatgtcccgcccgaggagttcctgcgccggcgcgcccaggcgctgaaggcc
taccacgagcacatgccgctgcgcttcgcccagacgccggtcggccccgacatgcagctc
taccgcagactggccttcggcgacctggtggacatgcacctgctcgacacccgccagtac
cgcgacccgcaggtgtccgacgccgagcgcggcgacccctcgcgcaccctgctcggcgcc
cggcagaagcagtggctgcgggaggggctgtcctcgtcgcgggcccgctggaacgtgctc
gcccagcaggtgttcttctcccagcgcgacttcgccgagggcggggcgaccgacttcagc
aacgacgcctgggacaactacctcgtggaccgcgacgaggtccgcgaccagctggcgcgc
acgcgcaacggggtggtgatcaccggggacgtgcacgccaactacgtgtgcgacgtcaag
gccgacttcgacgcccccgagtcgccgacggtggccaccgagctggtgggcacgtccgtc
accagcggcggcgacggcaccgaacaggcccccggcgacgaggttcagctgcgggagaac
ccgcacatcaggttcgtcaaccgcaagcggggctacgtgcgcaacgtcgtcacgcccacc
gagtggacggccgactaccgcgtcgtggaccacgtgagcgagccgggctcgcccatccgc
gaccgtgcgcggttcgtgatcgaggacggcgtggcgggcgtgcgcatggaggggtga

DBGET integrated database retrieval system