KEGG   Nocardiopsis dassonvillei: Ndas_2178Help
Entry
Ndas_2178         CDS       T01248                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ndas_2178
Enzymes [BR:nda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ndas_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2601899..2603074
Genome map
AA seq 391 aa AA seqDB search
MNTSLDDDTAAPPAHRPAEPATTAPLAGFTVAVTAARRAEEISALLRRKGAQVLAAPALR
IVPLSDDQRLASVSEQLARRPADVVVATTGIGFRGWVEACETWGTVDPLLASLRTSRLLA
RGPKAKGAIRAAGLTEEWSPPSESSAEVLDYLLARGVRGLRVAIQLHGEPLPDFTAALRL
AGADVVEVPVYRWTLPEDTAPLDRLIEAVTNGGVDAVTFTSAPAAAGLLARAHTTGHQAA
LVRALRGDVLAMCVGAVTARPLMAHDIPTVWPQRARVGAQVRALAEELPARFPTLSVAGH
RLRLRGHAVLVDGTVRTLSPTLMRVLRELARRPGQVLDRTRLLTCLGEDADAHAVETAVA
RLRTALGDPRIIQTVVKRGYRLALDPAERTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacctccctggacgacgacaccgcggccccgcccgcccaccgcccggccgaaccc
gccaccaccgcgccgctggccgggttcaccgtcgccgtcaccgccgcccgccgcgccgag
gagatcagcgccctgctgcgccgcaagggcgcccaggtcctggccgcaccggccctgcgc
atcgtgccgctcagcgacgaccagcgcctggcctcggtctccgaacagctcgcccgccgc
cccgccgacgtcgtcgtggccaccaccggcatcggcttccgcggctgggtggaggcgtgc
gagacctggggcaccgtcgacccgctcctggcgagcctgcgcacctcgcgcctgctggcc
cgcggccccaaggccaagggcgccatccgcgccgccggactcaccgaggagtggtcgccg
ccctcggagtcctccgccgaggtcctggactacctgctcgcccggggcgtgcggggtctg
cgcgtggccatccagctgcacggcgaacccctgcccgacttcaccgccgccctgcgcctg
gccggagccgacgtcgtcgaggtccccgtctaccgctggaccctgcccgaggacaccgcg
cccctggaccgcctcatcgaggccgtcaccaacgggggagtggacgcggtcaccttcacc
agcgccccggccgcggcggggctgctggcccgcgcccacaccaccggccaccaggccgcc
ctggtccgggccctgcgcggcgacgtcctggccatgtgcgtgggagcggtcaccgcacgc
cccctcatggcccacgacatccccaccgtgtggccccagcgcgcccgcgtcggcgcccag
gtccgcgcgctcgccgaggagctgcccgcacgctttccgaccctgtccgtggccggacac
cgcctgcgcctgcgcggccacgccgtcctggtcgacggcaccgtgcgcaccctctcgccc
accctgatgcgggtgctgcgcgagctggcgcgcaggcccggccaggtcctggaccgcacc
cgcctgctcacctgcctgggcgaggacgccgacgcccacgccgtggagacggccgtggcc
cggctgcgcaccgcgctgggcgacccccgcatcatccagaccgtggtcaaacgcggctac
cggctggccctggacccggccgaacgcaccctctga

DBGET integrated database retrieval system