KEGG   Nocardiopsis dassonvillei: Ndas_2196Help
Entry
Ndas_2196         CDS       T01248                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ndas_2196
Enzymes [BR:nda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Ndas_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2623378..2625726)
Genome map
AA seq 782 aa AA seqDB search
MALQEDELRGVDAYWRAANYLSVGQIYLLDNPLLREELRPEHIKPRLLGHWGTTPGLNFC
YAHLNRAIRDRDLEMMYVMGPGHGGPAAVANAWLEGTYSEVYRHVNQDVEGMRRLFRQFS
FPGGVPSHVAPETPGSIHEGGELGYSLAHAQGAAFDNPDLVVACVVGDGEAETGPLAGSW
RGNAFLDPVHDGAVLPILHLNGYKIANPTVLARIPERELLSYFEGLGYRPLLVSGEDPEY
MHRRMAEAVDEALEEIARIQHRARVSGVRGRAVWPVVILRSPKGWTGPAEVDGVPVEGTW
RSHQVPLGQVRSDEGHLRQLEEWMRSYRPEELFEESGAPVAEVRAQAPEGERRMSASPHA
NGGVLRRELVLPDFRGYAVDVGRNGTQTGEATRVLGRFLRDVIRSNPRTFRLMGPDETAS
NRLDAVFEASDKEWQAERLATDEHLGPGGRVMEVLSEHLCQGWLEGYLLTGRHGLFGCYE
AFVHIVDSMFNQHAKWLKVSRDLPWRRPISSLNYLLTSHVWRQDHNGFTHQDPGFLDVVL
NKPAEVVRVYLPPDANTLLSVADHCLRSSDYVNVVVAGKQPGLGYLSMEEAVAHCARGIG
IWEWASTDGGADPDVVLACAGDVPTLEVLAAADLVRRWLPGVRVRVVNVVDLMRLLPDSD
HPHGLPDAEYDALFTTDKPVVFAFHGYPWLVHRLTYRRAGHANLHVRGYRERGTTTTPFD
MVMLNDLDRFHLVMDVIDRVPGLGQRSAQVRQRMVDERLRHRAHTREFGEDPAEIREWVW
RY
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcaagaggacgaactacgaggcgtggacgcctactggcgggccgcgaactac
ctgtcggtcgggcagatctacctgctggacaacccgttgctgcgtgaggaactgcggccc
gagcacatcaagccgcgcctgctggggcactggggcaccaccccggggctgaacttctgc
tacgcgcacctgaaccgggcgatccgtgatcgggacctggagatgatgtacgtgatgggg
ccggggcacggcggtccggccgcggtggccaacgcctggctggagggcacctacagcgag
gtgtaccggcacgtgaaccaggacgtggaggggatgcggcggctgttccggcagttctcc
ttccccggcggggtgcccagccacgtggcgcccgagacgccggggtcgatccacgagggc
ggggagctggggtactcgctggcgcacgcccagggcgcggccttcgacaaccccgacctg
gtggtggcgtgcgtggtgggcgacggggaggccgagacgggccccctggcgggcagttgg
cgcggcaacgcgttcctggacccggtgcacgacggcgcggtgctgccgatcctgcacctg
aacgggtacaagatcgccaatcccacggtgctggcgcggatccccgagcgggaactgctg
tcctacttcgaggggctggggtaccggccgctgctggtcagcggtgaggatccggagtac
atgcacaggcggatggccgaggcggtggacgaggctctggaggagatcgcgcggatccag
caccgggcgcgggtgtcgggtgtgcgcgggcgcgcggtgtggccggtggtgatcctgcgt
tcgcccaaggggtggacggggccggcggaggtggacggtgtgccggtggaggggacgtgg
cgttcccaccaggtgccgttgggccaggtgcgttcggacgaggggcacctgaggcagttg
gaggagtggatgcgctcctaccggcccgaggagttgttcgaggagtcgggtgccccggtg
gccgaggtgcgcgcgcaggccccggagggcgaacggcggatgagtgcgagtccgcacgcc
aacggcggggtgctgcgtcgggagctggtgctgccggactttcgcgggtacgcggtggac
gtgggccggaacgggacgcagaccggtgaggcgactcgggtgctgggccgtttcctgcgg
gacgtgatccggtccaatccgcgcacgttccggttgatggggcctgacgagacggcctcc
aaccggttggacgcggtgttcgaggcctcggacaaggagtggcaggccgagcggctggcg
accgatgagcacctggggcccggcggccgggtgatggaggtgctcagcgagcacctgtgc
caggggtggttggaagggtacctgttgaccgggcggcacgggctgttcggctgttacgag
gcgttcgtgcacatcgtggactcgatgttcaaccagcacgcgaagtggttgaaggtgtcc
cgggatctgccgtggcggcggccgatctcgtcgttgaactacctgttgacctcgcacgtg
tggcgtcaggaccacaacgggttcacccaccaggatccggggttcctggacgtggtgctc
aacaagcccgcggaggtggtgcgcgtgtacctgccgccggacgccaacacgctgttgtcg
gtggccgaccactgcctgcgctccagcgactacgtgaacgtggtggtggcgggcaagcaa
ccggggctggggtacctgtcgatggaggaggcggtggcgcactgcgcgcgcgggatcggg
atctgggagtgggccagtaccgacggtggggcggatccggacgtggttctggcctgtgcg
ggtgacgtgcccacgttggaggttttggcggccgcggacctggtgcgccgctggttgccg
ggggtgcgggtacgggtggtcaacgtggtggacctgatgcggttgctgcccgacagcgat
cacccgcacgggttgcccgacgccgagtacgacgccctgttcaccacggacaagccggtg
gttttcgccttccacgggtatccgtggctggtgcaccggttgacctaccgcagggcgggc
cacgcgaacctgcacgtgcgcggataccgggagcggggcacgacgaccacaccgttcgac
atggtgatgctcaacgacctggaccggttccatctggtcatggacgtgatcgaccgggtt
ccgggactgggccagcggtcggcccaggtgcgtcagcggatggtggacgagcggttgcgg
caccgcgcccacacccgggagttcggtgaggatccggcggagatccgtgagtgggtgtgg
cggtactga

DBGET integrated database retrieval system