KEGG   Nocardiopsis dassonvillei: Ndas_2241Help
Entry
Ndas_2241         CDS       T01248                                 

Definition
agmatinase (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ndas_2241
Enzymes [BR:nda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Ndas_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2682844..2683791
Genome map
AA seq 315 aa AA seqDB search
MNAPIGPTDSSLVPRFAGPATFARLPRIDQVGHADIAVVGVPFDTGVSYRPGARFGPSAI
REASRLLRPYNPGLDVSPFASAQVVDGGDIAVNPFSIGDAVETLDQGASEFVRAGTRLVT
LGGDHTIALPLLRSLYRRHGPIALLHFDAHLDTWDTYFGEPYTHGTPFRRAVEEGILDTE
ALCHVGTRGPLYGKKDLEEDRRFGFGIVTSADVMRRGVDEVADALRQRIGNRPLYVSVDI
DVLDPAHAPGTGTPEAGGLTSRELLEILRGLASCNLVGADVVEVAPAYDHAQITATAASH
VAYDLVSVLALNHGG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcaccgatcggccccaccgactccagcctcgtaccgcgcttcgccggaccggcc
accttcgcccggctgccccgcatcgaccaggtcgggcacgccgacatcgccgtggtcggc
gtccccttcgacaccggcgtgtcctaccgccccggcgcgcgcttcggcccctcggccatc
cgcgaggccagccgcctgctgcgcccctacaacccgggcctggacgtgtccccgttcgcc
tccgcgcaggtggtcgacggcggcgacatcgcggtcaaccccttctcgatcggcgacgcg
gtggagaccctggaccagggcgcctccgagttcgtacgggcgggcacccgcctggtcacc
ctgggcggcgaccacaccatcgcgctgcccctgctgcgctcgctgtaccgccggcacggg
ccgatcgccctgctgcacttcgacgcccacctggacacctgggacacctacttcggcgag
ccctacacccacggcaccccgttccgccgcgccgtggaggagggcatcctggacaccgag
gccctgtgccacgtgggcacccgcggtccgctctacggcaagaaggacctggaggaggac
cgccgcttcggcttcggcatcgtcacctccgccgacgtcatgcgcaggggcgtggacgag
gtcgccgacgcgctgcgccagcgcatcgggaaccgcccgctgtacgtgtcggtggacatc
gacgtgctcgatccggcgcacgcgcccggcaccggcaccccggaggcgggcggcctgacc
agccgcgaactgctggagatcctgcgcgggctggcctcctgcaacctggtgggcgccgac
gtggtggaggtcgccccggcctacgaccacgcgcagatcaccgcgaccgccgcctcgcac
gtggcctacgacctggtcagcgtcctggcgctgaaccacgggggctga

DBGET integrated database retrieval system