KEGG   Nocardiopsis dassonvillei: Ndas_2418Help
Entry
Ndas_2418         CDS       T01248                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nda00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2867935..2868513)
Genome map
AA seq 192 aa AA seqDB search
MTLADLPRDSTVRDPLEDVARRLLIEIGEDPERSGLRDTPQRFARWWREFSDYQAGRVET
SFPLHTDGQIVMVSDVTVWSLCEHHLLPFSCVLTIAYRPDERVLGLSKFARIAHRHAHRL
QVQERLVRDIAEEVSKVAHTNDVAVIGRGEHLCMSMRGIRTPALMTCSAFDGIFRDYGPP
RDELVRIALSGN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggcagacctacctcgtgactccaccgtgcgcgatccgctggaggacgtggca
cggcggctcctcatcgagatcggtgaggacccggaacgcagtgggctgcgggacaccccg
cagcgcttcgcccgatggtggagggagttcagcgactaccaggccggccgggtcgagacc
agtttcccgctgcacaccgacggacagatcgtcatggtctccgacgtcaccgtgtggtcg
ctgtgcgaacaccacctcctgcccttctcctgcgtgctcaccatcgcctacaggccggac
gaacgcgtgctggggctgtccaagttcgcccggatcgcccaccgccacgcgcaccggctc
caggtccaggagcgcctggtgcgcgacatcgccgaggaggtctccaaggtggcccacacg
aacgacgtcgccgtcatcggccgcggcgagcacctgtgcatgtccatgcggggcatccgg
accccggccctcatgacctgctcggccttcgacgggatcttccgcgactacggtccgccg
cgcgacgagttggtcaggatcgccttgtccgggaactga

DBGET integrated database retrieval system