KEGG   Nocardiopsis dassonvillei: Ndas_2447Help
Entry
Ndas_2447         CDS       T01248                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nda  Nocardiopsis dassonvillei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2901007..2902440)
Genome map
AA seq 477 aa AA seqDB search
MLVTKGRRRLRGGAAAAVALALSLVTGGLTAAAHAEDTALTAQEAARAQQATLRELADQR
GLRMGTAVAPQHLNQAAYAQTAATEFNSVTHENDLKWETVQPQPGQFNWTNADRIVDFAQ
QNDQLIHGHTLVWHSQLPSWVRDGTFTEGQLLDVMDTHISTTVGRYRDDIATWDVVNEPI
GDDARFRDSVFYRTLGEDFIAEAFRMADRADPDARLFINDYNIDGINAKSDAYYDLVRDL
LAQGVPIDGIGFQGHLIAGQVPSSVQQNIQRFVDLGLEVMITELDIRIQLPVTQQKLEQQ
ARDYEQVVNACYAVDGCSGVIVWGVTDAHSWVPGTFPGQGAALPIDENYEPKPAYWSIHE
ALGGDPGPGPDPDPTDPPSGECEAVYSVTNQWQGGFQAQVTVTAGAALSGWTVEWTFGSG
ESVSHAWNASVSGSGGSVTATNVGYNGVLAAGQSTSFGFVGNSSGGVSTPELTCSAS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgttggtcaccaaggggcgaagacggctccgaggaggggccgcggccgcggtcgccctc
gccctcagcctggtcacgggcggcctgaccgccgccgcccacgccgaggacaccgcgctc
acggcgcaggaggcggcccgggcccaacaggccaccctgcgcgaactcgccgaccagcgc
gggctgcgcatgggcaccgcggtcgcgccgcagcacctgaaccaggcggcctacgcgcag
accgccgcgaccgagttcaactccgtcacccacgagaacgacctcaagtgggagaccgtc
cagccccagcccggacagttcaactggaccaacgccgaccgcatcgtggacttcgcccag
cagaacgaccagctgatccacggccacacgctggtgtggcacagccagctgccctcgtgg
gtgagggacggcaccttcaccgagggccagctgctggacgtcatggacacccacatcagc
accaccgtggggcgctaccgcgacgacatcgccacctgggacgtggtcaacgagcccatc
ggggacgacgcccggttccgcgactcggtcttctaccggacgctgggggaggacttcatc
gcggaggccttccggatggccgaccgggccgaccccgacgcccgcctgttcatcaacgac
tacaacatcgacgggatcaacgccaagagcgacgcctactacgacctggtccgggacctg
ctggcgcagggcgtgccgatcgacggcatcggcttccagggccacctcatcgcggggcag
gtcccctccagcgtccagcagaacatccagcgcttcgtggacctgggcctggaggtgatg
atcaccgagctggacatccgcatccagctgcccgtcacccagcagaaactggagcagcag
gccagggactacgagcaggtggtcaacgcctgctacgcggtcgacgggtgctcgggtgtg
atcgtgtggggcgtcaccgacgcccactcctgggttcccggtaccttcccgggccagggc
gcggcgctgcccatcgacgagaactacgagcccaagcccgcctactggtcgatccacgag
gcgctcggcggcgaccccggccccggcccggatcctgatccgaccgacccgccgtcgggt
gagtgtgaggcggtgtactcggtgacgaaccagtggcaggggggtttccaggcgcaggtg
acggtgacggcgggtgcggctctgtcggggtggaccgtggagtggaccttcggtagcggt
gagagtgtctcgcacgcctggaacgcgtcggtgtcgggcagcggtggcagtgtgaccgcg
acgaacgtgggttacaacggcgtgctggcggcggggcagtcgacctcgttcgggttcgtc
ggcaactccagcggcggtgtctcgacccccgagctgacgtgcagcgcgtcctga

DBGET integrated database retrieval system