KEGG   Nocardiopsis dassonvillei: Ndas_2765Help
Entry
Ndas_2765         CDS       T01248                                 

Definition
ATP-dependent exoDNAse (exonuclease V) subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nda00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ndas_2765
Enzymes [BR:nda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ndas_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3308871..3310961
Genome map
AA seq 696 aa AA seqDB search
MSEAEQVSAVLDRMGAPGALAPRLLGVLGPGAAAALDANPWLLLRLPQVTPEQADFCARR
HLGEGARPGDPRRLAALTGHVLRMSAARGHTVVEEKKLASVVGGFGVADPAAALEAAVAD
GSAVMLESTDEDDDEDFDFSEGGVPDLPDTELFYALPEVGHAEQRLGEQLLRLIGGNEPI
MDSMTAGETVDAAVERGGFTVSDRTREALVTATLRPVTVLRHGPGDAAEIARALVCLDAI
ATDSQVGIAVAAPTAQAAAAVNADLARIRGERATGGGSEGARVSGGAGGAPEAGAAEETW
GAGEDEAARGDESAEAASDAQGASHTQVASETQDTPDSQETPVTQGASGEQGSEEADEVR
EDREQPEQPEQQTQQSHEGQQDQQGPGEDVRSPVRAVSLPALLAQAPLKAGLVVLCEAMS
VGAARAAELASVCADDAHLVLLADPNQAPSATPGQVVVDIAASRTAHVAEVADDDAPGPI
AELAAGVASGGVPEVEAPGREVVRVPAASAEEAVHRVVQLVTDSIPRALGIGAEHVQVVT
AREDGPAGARAVNAACKERLNPGPGAHGGFDVGDRVLFTAEGPGYGPGDTGHLREVGGGA
VVELVGGGRVKVTDPAALRPGWAVTVAAAHGGRWPAVVAVFPPEVPVSRPQVYTALTRAT
RHVSLVDATGGGLETGVRENAAKERTTRLVRILREG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaggcagaacaggtcagtgccgtccttgaccggatgggcgcgccgggcgccctg
gcgccccggctgctgggcgtgctggggccaggggccgccgccgcgctggacgcgaacccg
tggctgctgctgcgcctgccgcaggtgaccccggagcaggccgacttctgcgcccgcagg
cacctgggcgagggcgcgcggcccggcgacccccggcggctggcggcgctcaccgggcac
gtactgcgcatgtccgccgcgcgcgggcacaccgtggtcgaggagaagaagctggcctcg
gtcgtgggcgggttcggggtggccgatccggccgccgcgctggaggcggccgtggccgac
gggagcgcggtgatgctggagagcaccgacgaggacgacgacgaggacttcgacttcagc
gagggcggagtcccggacctgcccgacaccgaactgttctacgcgctgcccgaggtgggg
cacgccgaacagcggctgggcgaacagctgctgcggctgatcggcggcaacgagccgatc
atggactcgatgaccgcgggtgagacggtggacgcggccgtggagcggggcgggttcacc
gtttcggaccgcacgcgcgaggccctggtgacggcgaccctgcgcccggtgacggtgctg
cggcacggccctggcgacgccgcggagatcgcgcgggcgctggtgtgcctggacgcgatc
gccaccgacagccaggtggggatcgcggtggctgcgccgaccgcgcaggccgcggcggcc
gtcaacgccgacctggcgcggatccgcggggagcgggccacgggcgggggttccgaggga
gcgcgggtttccgggggtgccggaggggcaccggaggccggggccgccgaggagacctgg
ggtgccggggaggacgaagcggcgcggggggacgagagcgctgaggcggcctcggatgcg
cagggggcttcgcacacacaggtggcttcggagacacaagacactccggactcgcaggaa
accccggtgacacagggggcttcgggcgagcaggggtccgaagaggctgacgaagtgcgg
gaggaccgagagcagccggaacagccggaacagcagacgcagcagagccacgagggacag
caggaccagcaggggcccggcgaggacgttcggtcccccgtgcgggcggtgtcgctgccc
gcgctcctggcgcaggcgccgctgaaggccggtctggtggtgctgtgcgaggcgatgtcg
gtgggcgcggcccgtgccgccgaactggcttcggtgtgcgcggacgacgcccacctggtg
ctgctggccgacccgaaccaggcgccctcggccacgccgggccaggtggtggtggacatc
gccgcgtcgcggaccgcgcacgtggccgaggtggccgacgacgacgcgccggggccgatc
gcggagctggcggcgggcgtggcctcgggcggggttcccgaggtggaggcgcccggacgc
gaggtggtgcgggttccggcggcgtcggcagaggaggcggtgcaccgggtggtgcagctg
gtgacggactcgattccgcgcgcgttggggatcggggccgagcacgtgcaggtggtgacc
gcgcgggaggacggcccggccggtgcacgggcggtcaacgccgcgtgcaaggagaggctg
aacccggggccgggtgcgcacggcgggttcgacgtgggcgaccgggtgctgttcacggcg
gagggccccggctacgggcccggtgacaccggtcatctgcgcgaggtgggcggcggtgcc
gtggtggagctggtcggcggcggtcgggtgaaggtgaccgacccggcggcgctgcgcccg
ggctgggcggtgacggtggccgccgcgcacgggggccggtggcccgccgtggtggcggtg
ttcccgccggaggtgccggtgtcgcggccacaggtgtacacggcgctgacccgggcgacg
cggcacgtgtcgctggtggacgcgaccggcggcgggctggagaccggtgtgcgggagaac
gcggcgaaggagcggacgacccgcctggtgaggatcctgcgcgaggggtag

DBGET integrated database retrieval system