KEGG   Nocardiopsis dassonvillei: Ndas_3008Help
Entry
Ndas_3008         CDS       T01248                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_3008
   01230 Biosynthesis of amino acids
    Ndas_3008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_3008
   00051 Fructose and mannose metabolism
    Ndas_3008
   00562 Inositol phosphate metabolism
    Ndas_3008
Enzymes [BR:nda01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ndas_3008
Exosome [BR:nda04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ndas_3008
  Exosomal proteins of bladder cancer cells
   Ndas_3008
  Exosomal proteins of melanoma cells
   Ndas_3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3591323..3592099)
Genome map
AA seq 258 aa AA seqDB search
MSQRLPLIAGNWKMNNNHLEAIALVQKLAFALNDKDYDKAEVVVLPPFTDLRSVQTLVDG
DKLKIVYGAQDISAHEKGAYTGEISGSMLAKLDCSYVLVGHSERREYHREDDALVNTKVK
AAFANGIVPILCVGEGLEVRKAGQQVEHVLAQLDGALKEVPAEQAERIVVAYEPVWAIGT
GEVATPEDAQEVCSAVRARLAELYSPEVAGAVRVLYGGSVKGDNAPGIMAKDDVDGALVG
GACLKADEFVKIIRFGDN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcgcctgccgctcatcgcgggcaactggaagatgaacaacaaccacctggag
gcgatcgcgctcgtccagaagctggcgttcgcgctcaacgacaaggactacgacaaggcc
gaggtcgtcgtcctgccgccgttcaccgacctgcgcagcgtccagaccctggtcgacggc
gacaagctcaagatcgtctacggcgcccaggacatctccgcgcacgagaagggcgcctac
accggcgagatctccgggtccatgctggccaagctggactgctcctacgtgctggtgggc
cactccgagcgccgcgagtaccaccgcgaggacgacgccctggtcaacaccaaggtcaag
gcggcgttcgccaacggcatcgtcccgatcctgtgcgtgggcgagggcctggaggtccgc
aaggcgggccagcaggtcgagcacgtcctggcccagttggacggcgccctcaaggaggtc
ccggccgagcaggccgagaggatcgtcgtcgcctacgagcccgtgtgggccatcggcacc
ggcgaggtcgccacccccgaggacgcccaggaggtgtgctcggccgtccgcgcgcgcctg
gccgagctgtactcgcccgaggtcgcgggcgcggtgcgcgtcctctacggcggttcggtc
aagggcgacaacgcccccggcatcatggccaaggacgacgtggacggggccctggtcggc
ggcgcctgcctcaaggccgacgagttcgtgaagatcatccgcttcggcgacaactag

DBGET integrated database retrieval system