KEGG   Nocardiopsis dassonvillei: Ndas_3105Help
Entry
Ndas_3105         CDS       T01248                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ndas_3105
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ndas_3105
Enzymes [BR:nda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ndas_3105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3719947..3720855)
Genome map
AA seq 302 aa AA seqDB search
MRHLLSTGDLSRDEATLILDTAAELAQVGDRSVKKLPTLRGRTVVNLFYEDSTRTRTSFE
LAAKRLSADVINFSAKGSSVSKGESLKDTALTLQAMGADGVVIRHSASGAARRLANWVDG
SVLNAGDGTHEHPTQALLDAFTMRSRLGRLEGLRVAVVGDILHSRVARSNVLLLTTLGAH
VTLVAPPTLLPVSVHTWPCEVSYDLDEVLPKSDVVMMLRVQAERMHESFFPSTREYSRNY
GLDGERLSRMPEEAIVMHPGPMVRGMEISAEVADSPRCTVTEQVANGVSLRMAVLYLLLG
GS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacctgctctccaccggcgacctctcccgcgacgaggccaccctcatcctggac
accgccgccgaactcgcccaggtcggcgaccgctccgtcaagaagctgcccaccctgcgc
gggcgcaccgtggtcaacctcttctacgaggactccacccgcacccgcacctccttcgag
ctggccgccaagcgcctgtccgcggacgtcatcaacttctccgccaagggctccagcgtc
tccaagggcgagagcctcaaggacaccgcgctgaccctccaggccatgggcgccgacggc
gtcgtcatccggcacagcgcctccggcgccgcccgccgcctcgccaactgggtggacggg
tccgtcctcaacgcgggcgacggcacccacgaacaccccacccaggccctgctggacgcc
ttcaccatgcgctcgcgcctggggcgcctggaggggctgcgggtggccgtcgtcggcgac
atcctgcacagccgggtcgcccgctccaacgtgctgctgctcaccaccctgggcgcgcac
gtcaccctggtcgcgccgcccaccctgctgccggtctcggtgcacacctggccgtgcgag
gtctcctacgacctcgacgaggtcctgcccaagtccgacgtcgtcatgatgctgcgcgta
caggccgagcgcatgcacgagtcgttcttcccgtccacgcgcgagtacagccgcaactac
ggcctggacggcgagcgcctgtcccgcatgcccgaggaggcgatcgtcatgcaccccggc
ccgatggtccgcggcatggagatctccgccgaggtcgccgactcgccccgctgcaccgtc
accgaacaggtcgccaacggcgtcagcctgcgcatggccgtgctctacctgctgctcggc
ggctcctga

DBGET integrated database retrieval system