KEGG   Nocardiopsis dassonvillei: Ndas_3121Help
Entry
Ndas_3121         CDS       T01248                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_3121
   01230 Biosynthesis of amino acids
    Ndas_3121
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_3121
   00030 Pentose phosphate pathway
    Ndas_3121
   00051 Fructose and mannose metabolism
    Ndas_3121
   00052 Galactose metabolism
    Ndas_3121
  Energy metabolism
   00680 Methane metabolism
    Ndas_3121
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ndas_3121
Enzymes [BR:nda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ndas_3121
Protein phosphatases and associated proteins [BR:nda01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ndas_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3736168..3737193
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIKDYGYEFIGFRDGWRGPLEGDTMPLDVTAVRGI
LPRGGTILGSSRTNLMKIEGGVERVKDNMAGLGVDALVAIGGEDTLGVARQLHDRGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIAMEAIDRLHTTAESHHRALVVEVMGRHAGWIALHS
GMAAGANVILIPERPFDIDEVVKHVESRFETQYAPIIVVAEGAHPKEGQMELATGETDSF
GHVRLGGIGQRLADEIEQRTGKEARSVVLGHVQRGGTPTAFDRVLATRLGVNAIEAVHDK
AFGKMVGLQGTDIVRVNLAEATDTLKTVPSSRYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggggtgctgaccggcggtggggactgccctggtctgaacgcggtcatccgc
gcagtggtccgcaagggcatcaaggactacggctacgagttcatcggcttccgggacggc
tggcgcggcccgctggagggcgacaccatgccgctggacgtgaccgccgtgcgcggcatc
ctgccccggggcggcacgatcctgggctcctcgcgcaccaacctcatgaagatcgagggc
ggtgtcgaacgggtcaaggacaacatggccgggctgggcgtcgacgccctggtcgccatc
ggcggcgaggacaccctcggcgtggcccgccagctgcacgaccgcggcgtcaacgtcgtc
ggcgtgcccaagaccatcgacaacgacctcaacgcgaccgactacaccttcggtttcgac
acggccgtgaacatcgcgatggaggcgatcgaccgcctgcacaccaccgccgagtcgcac
caccgcgcgctggtggtggaggtcatgggccgccacgccggatggatcgcgctgcactcg
ggcatggccgcgggcgccaacgtcatcctcatccccgagcggcccttcgacatcgacgag
gtcgtcaagcacgtcgagagccgcttcgagacccagtacgcgccgatcatcgtggtcgcc
gagggcgcgcaccccaaggagggccagatggagctggccaccggggagaccgactccttc
ggccacgtgcgcctgggcggcatcggccagcggctggccgacgagatcgagcagcgcacc
ggcaaggaggcccgctcggtggtcctgggccacgtgcagcgcggcggcacgccgaccgcg
ttcgaccgcgtgctggccacccgtctgggcgtgaacgccatcgaggccgtgcacgacaag
gccttcggcaagatggtcggcctccagggcacggacatcgtccgcgtgaacctggccgag
gccaccgacaccctcaagacggtgccctcctcgcgctacgaggaggccgaggtcttcttc
ggctag

DBGET integrated database retrieval system