KEGG   Nocardiopsis dassonvillei: Ndas_3174Help
Entry
Ndas_3174         CDS       T01248                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00260  Glycine, serine and threonine metabolism
nda00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01130  Biosynthesis of antibiotics
nda01230  Biosynthesis of amino acids
Module
nda_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_3174
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ndas_3174
Enzymes [BR:nda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ndas_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADH68582
UniProt: D7B2C5
Position
1:complement(3799957..3801174)
Genome map
AA seq 405 aa AA seqDB search
MSHDQPLPDQLGHYGRFGGRFAPEALVAALDEVAAEWEKAKQDPQYQAELAELLKDYTGR
PSALSEARNFSEHCGGARILLKREDLNHTGSHKINNVLGQALLTRRMGKTRVIAETGAGQ
HGVATATACALLGLECVIYMGEEDTRRQALNVARMRMLGAEVVPVTIGSRTLKDAINEAF
RDWVANVDRTHYLFGTVAGPHPFPKLVRDLHFVVGQEAREQVLERVGRLPDAVAACVGGG
SNAMAVFAAFIPDEEVALYGFEAGGEGARTTRTAASITAGSPGVFHGARTFVLQDEYGQT
LPSHSISAGLDYPAVGPEHAYLADTGRATYEPVTDAEAMEAFRLLCRTEGIIPAIESAHA
LAGARKLGERLGPDAVILVNLSGRGDKDVDTAAAYFGLVDPEGQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgaccaacccctgcccgaccagctcgggcactacggccgcttcggcggccgc
ttcgcgcccgaagccctcgtcgccgccctcgacgaggtggccgcggagtgggagaaggcc
aagcaggacccccagtaccaggccgaactcgccgaactgctcaaggactacaccgggcgc
cccagcgccctgagcgaggcccgcaacttctccgagcactgcggcggcgcgcggatcctg
ctcaagcgcgaggacctcaaccacaccggatcccacaagatcaacaacgtcctcggccag
gccctgctcaccaggcgcatgggcaagacccgcgtcatcgccgagaccggagccggacag
cacggcgtggccaccgccacagcctgcgccctgctcggcctggagtgcgtgatctacatg
ggcgaggaggacacccgccgccaggcgctcaacgtcgcccgcatgcgcatgctcggcgcc
gaggtcgtccccgtcaccatcggcagccgcaccctcaaggacgccatcaacgaggccttc
cgcgactgggtggccaacgtcgaccgcacccactacctgttcggcaccgtcgccggaccg
caccccttccccaagctcgtgcgcgacctgcacttcgtcgtcggccaggaggcccgcgaa
caggtcctggagcgcgtcggcaggctccccgacgcggtcgccgcgtgcgtgggcggcggc
tccaacgccatggccgtcttcgcggccttcatccccgacgaggaggtcgccctgtacggc
ttcgaggccggtggggagggggcgcggaccacccgcaccgccgcctccatcacggcgggc
agccccggcgtcttccacggggcgcgcaccttcgtgctccaggacgagtacggccagacc
ctgcccagccactccatctccgccggactcgactacccggcggtgggccccgagcacgcc
tacctcgccgacaccggccgcgccacctacgagccggtcaccgacgccgaggcgatggag
gccttccggctgctgtgccgcaccgagggcatcatccccgccatcgagagcgcgcacgcc
ctggccggcgcccgcaagctcggcgagcgcctcggcccggacgccgtcatcctggtgaac
ctctccgggcgcggcgacaaggacgttgacaccgcggccgcctacttcggcctcgtcgac
ccggagggacaggcgtga

DBGET integrated database retrieval system