KEGG   Nocardiopsis dassonvillei: Ndas_3174Help
Entry
Ndas_3174         CDS       T01248                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ndas_3174
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_3174
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ndas_3174
Enzymes [BR:nda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ndas_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(3799957..3801174)
Genome map
AA seq 405 aa AA seqDB search
MSHDQPLPDQLGHYGRFGGRFAPEALVAALDEVAAEWEKAKQDPQYQAELAELLKDYTGR
PSALSEARNFSEHCGGARILLKREDLNHTGSHKINNVLGQALLTRRMGKTRVIAETGAGQ
HGVATATACALLGLECVIYMGEEDTRRQALNVARMRMLGAEVVPVTIGSRTLKDAINEAF
RDWVANVDRTHYLFGTVAGPHPFPKLVRDLHFVVGQEAREQVLERVGRLPDAVAACVGGG
SNAMAVFAAFIPDEEVALYGFEAGGEGARTTRTAASITAGSPGVFHGARTFVLQDEYGQT
LPSHSISAGLDYPAVGPEHAYLADTGRATYEPVTDAEAMEAFRLLCRTEGIIPAIESAHA
LAGARKLGERLGPDAVILVNLSGRGDKDVDTAAAYFGLVDPEGQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgaccaacccctgcccgaccagctcgggcactacggccgcttcggcggccgc
ttcgcgcccgaagccctcgtcgccgccctcgacgaggtggccgcggagtgggagaaggcc
aagcaggacccccagtaccaggccgaactcgccgaactgctcaaggactacaccgggcgc
cccagcgccctgagcgaggcccgcaacttctccgagcactgcggcggcgcgcggatcctg
ctcaagcgcgaggacctcaaccacaccggatcccacaagatcaacaacgtcctcggccag
gccctgctcaccaggcgcatgggcaagacccgcgtcatcgccgagaccggagccggacag
cacggcgtggccaccgccacagcctgcgccctgctcggcctggagtgcgtgatctacatg
ggcgaggaggacacccgccgccaggcgctcaacgtcgcccgcatgcgcatgctcggcgcc
gaggtcgtccccgtcaccatcggcagccgcaccctcaaggacgccatcaacgaggccttc
cgcgactgggtggccaacgtcgaccgcacccactacctgttcggcaccgtcgccggaccg
caccccttccccaagctcgtgcgcgacctgcacttcgtcgtcggccaggaggcccgcgaa
caggtcctggagcgcgtcggcaggctccccgacgcggtcgccgcgtgcgtgggcggcggc
tccaacgccatggccgtcttcgcggccttcatccccgacgaggaggtcgccctgtacggc
ttcgaggccggtggggagggggcgcggaccacccgcaccgccgcctccatcacggcgggc
agccccggcgtcttccacggggcgcgcaccttcgtgctccaggacgagtacggccagacc
ctgcccagccactccatctccgccggactcgactacccggcggtgggccccgagcacgcc
tacctcgccgacaccggccgcgccacctacgagccggtcaccgacgccgaggcgatggag
gccttccggctgctgtgccgcaccgagggcatcatccccgccatcgagagcgcgcacgcc
ctggccggcgcccgcaagctcggcgagcgcctcggcccggacgccgtcatcctggtgaac
ctctccgggcgcggcgacaaggacgttgacaccgcggccgcctacttcggcctcgtcgac
ccggagggacaggcgtga

DBGET integrated database retrieval system