KEGG   Nocardiopsis dassonvillei: Ndas_3175Help
Entry
Ndas_3175         CDS       T01248                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01130  Biosynthesis of antibiotics
nda01230  Biosynthesis of amino acids
Module
nda_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ndas_3175
Enzymes [BR:nda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ndas_3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADH68583
UniProt: D7B2C6
Position
1:complement(3801415..3802221)
Genome map
AA seq 268 aa AA seqDB search
MSVLDEILDGVRADLAQRQEDLPLDRLKAQAGSVPTPKDAEAALRRPGVHVIAEVKRASP
SKGPLAAITDPAALARDYEAGGAALISVLTEQRRFKGSLADLQAVHKAVDTPLLRKDFVV
SSYQLWEARVFGASAVLLIVAALPQEALVSLVERARSLGLMPLVEVHDEEEVARALDAGA
TVVGVNARNLKTLEVDRDTFSRLAPLIPSDVVKIAESGVRGPHDLLAYAGAGAGAVLVGE
SLVRGRNPREAVADLVTAGAHPALRDRN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgctcgacgagatcctcgacggagtacgcgctgacctggcgcagcggcaggag
gacctgccccttgaccgcctcaaggcccaggccgggtcggtgcccaccccgaaggacgcc
gaagccgccctgcgccgcccgggcgtgcacgtcatcgccgaggtcaagcgggccagcccc
tccaagggccccctcgcggccatcaccgaccccgcggccctggcccgcgactacgaggcc
ggcggcgccgccctgatcagcgtcctcaccgagcagcgccgcttcaagggcagcctcgcc
gacctccaggccgtccacaaggcggtcgacaccccgctgctgcgcaaggacttcgtggtc
agctcctaccagctgtgggaggcccgcgtcttcggcgcctccgccgtgctgctcatcgtc
gcggccctgccccaggaggccctggtctccctggtggagcgggcccgctcgctcggcctc
atgccgctggtggaggtccacgacgaggaggaggtcgcgcgcgcactcgacgccggggcc
accgtcgtcggcgtcaacgcccgcaacctcaagaccctggaggtggaccgggacaccttc
tcccggctcgcccccctcatcccctccgacgtcgtcaagatcgccgagtccggtgtccgc
ggcccgcacgacctgctggcctacgccggagccggagccggggccgtcctcgtcggcgag
agcctcgtccgcggccgcaacccgcgcgaggccgtcgccgacctggtcaccgccggggcc
caccccgccctgcgggaccggaactag

DBGET integrated database retrieval system