KEGG   Nocardiopsis dassonvillei: Ndas_3234Help
Entry
Ndas_3234         CDS       T01248                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ndas_3234
Enzymes [BR:nda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ndas_3234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3866205..3867500)
Genome map
AA seq 431 aa AA seqDB search
MDVIEIIRAKRDGGELSPGQIDWVIDAYTRGEVAEEQMSALAMAIFLRGMDRAEVSRWTE
AMLASGERLDFSDLARPTTDKHSTGGVGDKITLPLTPTVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRASLSTGEMREVLDSTGGVICAAGSGLAPADRKLYALRDVTGTVESIPLI
AASIMSKKLAEGTGALVLDVKVGSGAFMKDADSARELARTMVDIGNDHGVRTVALLTDMS
VPLGRQVGNALEVAESVEVLSGGGPADVVELTVALAREMLAAAGLVPGEGGVKDPAEALR
DGSALESWKRLVRAQGGDPDAPLPVAAERRVVLAPASGTVTRLDAYQVGLAAWRLGAGRA
RKEDAVSFGAGVTLHAKPGESVQAGEPLFTLHADEAERFERAAEALEGAFDIEPEGGAGY
EARPLVIDRIA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatcgagatcatccgagccaagcgcgacgggggagagctgagccccggccag
atcgactgggtgatcgacgcctacacccgcggcgaggtggccgaggagcagatgtcggcg
ctggccatggcgatcttcctgcgcgggatggaccgggccgaggtgagccgctggaccgag
gcgatgctggcctcgggggagcgcctggacttctccgacctggcgcggcccaccaccgac
aagcactccacgggcggggtgggcgacaagatcaccctgccgctcacacccaccgtcgcg
gcctgcggggcggccgtgccgcagctgtcggggcgcgggctcgggcacaccggcgggacc
ctggacaagctggagtcgatccccgggtggcgggcctcgctgtccaccggcgagatgcgg
gaggtgctggactccacgggcggggtgatctgcgcggccgggtccgggctggccccggcc
gaccgcaagctctacgccctgcgcgacgtgaccggcacggtcgagtcgatcccgctgatc
gccgcgtccatcatgagcaagaagctcgccgagggcaccggcgcgctggtcctggacgtc
aaggtgggttcgggggcgttcatgaaggacgccgactccgcgcgcgagctggcccgcacg
atggtcgacatcggaaacgaccacggcgtgcgcacggtcgcgctgctcaccgacatgtcg
gtcccgctgggcaggcaggtgggcaacgccctggaggtggccgagtccgtggaggtgctg
tcgggcggcgggcccgcggacgtggtggagctgaccgtggccctggcccgggagatgctg
gccgcggccgggctcgtccccggtgagggcggggtcaaggacccggccgaggcgctgcgg
gacggcagcgcgctggagtcgtggaagcggctggtccgggcacagggcggggacccggac
gcgccgctgccggtggccgccgagcgccgggtggtgctcgctccggcctcggggacggtg
acccggctggacgcctaccaggtggggctggccgcgtggcggctgggcgcgggccgggcg
cgcaaggaggacgcggtgtcgttcggggcgggggtgaccctgcacgccaagccgggggag
tccgtgcaggccggggagccgctgttcacgctgcacgcggacgaggcggagcggttcgag
cgggcggccgaggcgctggagggcgccttcgacatcgagccggagggcggggcgggctac
gaggcccggccgctggtgatcgaccggatcgcctga

DBGET integrated database retrieval system