KEGG   Nocardiopsis dassonvillei: Ndas_3234Help
Entry
Ndas_3234         CDS       T01248                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00240  Pyrimidine metabolism
nda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ndas_3234
Enzymes [BR:nda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ndas_3234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2 DUF2254 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ADH68640
UniProt: D7B2I3
Position
1:complement(3866205..3867500)
Genome map
AA seq 431 aa AA seqDB search
MDVIEIIRAKRDGGELSPGQIDWVIDAYTRGEVAEEQMSALAMAIFLRGMDRAEVSRWTE
AMLASGERLDFSDLARPTTDKHSTGGVGDKITLPLTPTVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRASLSTGEMREVLDSTGGVICAAGSGLAPADRKLYALRDVTGTVESIPLI
AASIMSKKLAEGTGALVLDVKVGSGAFMKDADSARELARTMVDIGNDHGVRTVALLTDMS
VPLGRQVGNALEVAESVEVLSGGGPADVVELTVALAREMLAAAGLVPGEGGVKDPAEALR
DGSALESWKRLVRAQGGDPDAPLPVAAERRVVLAPASGTVTRLDAYQVGLAAWRLGAGRA
RKEDAVSFGAGVTLHAKPGESVQAGEPLFTLHADEAERFERAAEALEGAFDIEPEGGAGY
EARPLVIDRIA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatcgagatcatccgagccaagcgcgacgggggagagctgagccccggccag
atcgactgggtgatcgacgcctacacccgcggcgaggtggccgaggagcagatgtcggcg
ctggccatggcgatcttcctgcgcgggatggaccgggccgaggtgagccgctggaccgag
gcgatgctggcctcgggggagcgcctggacttctccgacctggcgcggcccaccaccgac
aagcactccacgggcggggtgggcgacaagatcaccctgccgctcacacccaccgtcgcg
gcctgcggggcggccgtgccgcagctgtcggggcgcgggctcgggcacaccggcgggacc
ctggacaagctggagtcgatccccgggtggcgggcctcgctgtccaccggcgagatgcgg
gaggtgctggactccacgggcggggtgatctgcgcggccgggtccgggctggccccggcc
gaccgcaagctctacgccctgcgcgacgtgaccggcacggtcgagtcgatcccgctgatc
gccgcgtccatcatgagcaagaagctcgccgagggcaccggcgcgctggtcctggacgtc
aaggtgggttcgggggcgttcatgaaggacgccgactccgcgcgcgagctggcccgcacg
atggtcgacatcggaaacgaccacggcgtgcgcacggtcgcgctgctcaccgacatgtcg
gtcccgctgggcaggcaggtgggcaacgccctggaggtggccgagtccgtggaggtgctg
tcgggcggcgggcccgcggacgtggtggagctgaccgtggccctggcccgggagatgctg
gccgcggccgggctcgtccccggtgagggcggggtcaaggacccggccgaggcgctgcgg
gacggcagcgcgctggagtcgtggaagcggctggtccgggcacagggcggggacccggac
gcgccgctgccggtggccgccgagcgccgggtggtgctcgctccggcctcggggacggtg
acccggctggacgcctaccaggtggggctggccgcgtggcggctgggcgcgggccgggcg
cgcaaggaggacgcggtgtcgttcggggcgggggtgaccctgcacgccaagccgggggag
tccgtgcaggccggggagccgctgttcacgctgcacgcggacgaggcggagcggttcgag
cgggcggccgaggcgctggagggcgccttcgacatcgagccggagggcggggcgggctac
gaggcccggccgctggtgatcgaccggatcgcctga

DBGET integrated database retrieval system