KEGG   Nocardiopsis dassonvillei: Ndas_3290Help
Entry
Ndas_3290         CDS       T01248                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Ndas_3290
Enzymes [BR:nda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Ndas_3290
Transfer RNA biogenesis [BR:nda03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Ndas_3290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3925945..3926754
Genome map
AA seq 269 aa AA seqDB search
MTGSATGTAGAHPLAEAMAAAVVEVGGLLREWRSDADARSGAWEGSQFKARADAMAHRAL
SERLTAIDGRIPVVSEEDPESLRGERPHRYWLIDPVDGTASYVHGFPGYVTQVALVDGGR
PEAAAVFAPETATLYTAVRGRGARRDGRPLPPPRPAPPGRGVLTDNTPGPEGIARRVGDR
FGYGGYLESGSISLKLCLVAEGSAHLFVKDVPVRDWDVAAPALVLEEVGGLVTRLDGSPF
DYRGPYEHTGLVGAADPAACRAVSDWLGS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggctccgcgacggggaccgccggcgcgcacccgctggccgaggcgatggcggcg
gcggtcgtggaggtcggcggtctgctgcgggagtggcgctccgacgcggacgcgcgcagc
ggggcgtgggaggggagccagttcaaggcccgggccgacgccatggcgcaccgggccctg
tccgagcggctcaccgcgatcgacggccggatcccggtggtcagcgaggaggaccccgag
tcgctgcgcggcgagcggccgcaccggtactggctgatcgaccccgtcgacgggaccgcc
agctacgtccacgggttccccgggtacgtcacgcaggtcgcgctggtggacggggggcgg
ccggaggcggccgccgtgttcgcccccgagaccgcgaccctctacacggccgtgcgcggc
cggggcgcgcgtcgggacggacgccccctgccgcccccgcggcccgccccgccgggacgg
ggtgtgctcaccgacaacaccccggggccggaggggatcgcccgcagggtcggcgaccgc
ttcggctacggcgggtacctggagagcggcagcatctcgctgaagctgtgcctggtcgcc
gagggttccgcgcacctgttcgtcaaggacgtgccggtgcgcgactgggacgtggcggcg
cccgccctggtcctggaggaggtgggcggcctggtcacccggctggacggaagcccgttc
gactaccgggggccctacgagcacaccgggctggtgggcgccgccgaccccgccgcgtgc
cgggccgtctccgactggctgggctcctga

DBGET integrated database retrieval system