KEGG   Nocardiopsis dassonvillei: Ndas_3414Help
Entry
Ndas_3414         CDS       T01248                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ndas_3414
Enzymes [BR:nda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ndas_3414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4081988..4084021)
Genome map
AA seq 677 aa AA seqDB search
MRDVQLARLAEQHGVATTYEDWRGRRVPVSPDTIRHVLAALGVDPAAPDAGAAPGPLPPA
VVVREGKAPDLVLAEGTHSVVETCGGSLLPFGPGLPLGVHTLRVTDGAAEHTAPLLVAPD
RIEPSALRDHPRLWGIMAQVYSVRSRASWGTGDLRDLAELADWSARDLGADFALINPVHA
TEPLPPVEPSPYLPVSRRYASPLYIRIEDVPEYARLDPAQREGIQRLARPLRERGRTADL
LDRDSVWRAKRAALEVLFESPRAPGREASLRAYLEREGRPLVEFATWSALAERHGTDYRT
WPQGLRGVHSRDVGEEALRRWPAVEFHRWLQWILDEQLSQAQTTAETGGMAVGIVHDLAI
GVQAGGADAWMYGDALVPGLHVGAPPDEFNRQGQDWGQPPWHPRRLAGRGYEPFRQILAQ
AFRYAGGVRIDHVMGMFRLWCVPEGASAAEGTYVRFDHEGMVGTLALAAHRADAVVVGED
LGTVEPWVREHLADRGILGTSVLWFEQDADGRPRPPEEWRTDCLATVATHDLPPVASFLS
TEHVELRDRLGLLGRPVEEERADAESRVERWRELLVELGLLDEDVDPVADSAAVVAAMHA
YLVATPARMIGVALTDVVGERRMQNQPGTSDEYPNWRIPLTSGEGEPVLVDELLADPRMV
ARIRRTLGPVGRRDHAP
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
gtgagggacgttcagctggcacggttggccgagcagcacggagtcgcgacgacctacgag
gactggcgggggcgcagggtcccggtcagccccgacaccatccgccatgtcctggccgcc
ctgggcgtggacccggcggccccggacgcgggggcggcgccgggcccgctgccgcccgcg
gtcgtcgtccgcgagggcaaggcgcccgacctcgtgctcgccgaggggacgcacagcgtc
gtcgagacctgcggcggctccctgctgcccttcggccccgggctgccgctgggcgtgcac
accctgcgcgtcaccgacggcgccgccgagcacaccgcgcccctgctcgtggcccccgac
cgcatcgaacccagcgcgctcagggaccacccgcgcctgtgggggatcatggcgcaggtc
tacagcgtgcgctcccgcgcctcctggggcaccggcgacctgcgcgacctcgccgagctc
gccgactggagcgcgcgcgacctgggcgccgacttcgccctgatcaacccggtgcacgcc
accgagccgctgcccccggtggagccctcgccctacctgccggtcagccgccgctacgcc
agccccctctacatccgcatcgaggacgtgcccgagtacgcccggctcgaccccgcccag
cgcgagggcatccagcgcctggcccggccgctgcgcgaacgcggccgcaccgccgacctc
ctcgaccgcgactccgtgtggagggccaagcgcgccgccctggaggtcctcttcgagtcg
ccccgcgcccccggccgcgaggcctccctgcgcgcctacctcgaacgcgagggccgaccg
ctggtcgagttcgccacctggtcggccctggccgagcggcacggcaccgactaccggacc
tggccgcaggggctgcgcggggtccacagccgcgacgtcggggaggaggccctgcgccgg
tggcccgccgtggagttccaccgctggctccagtggatcctcgacgagcagctctcccag
gcgcagaccaccgccgagaccggcgggatggccgtcggcatcgtgcacgacctggccatc
ggggtgcaggcgggcggcgcggacgcgtggatgtacggggacgccctcgtgcccggcctg
cacgtgggggcgcccccggacgagttcaaccggcaggggcaggactggggccagccgccc
tggcacccccggcgcctggccgggcgcggctacgaaccgttccgccagatcctggcccag
gcgttccgctacgcgggcggggtccgcatcgaccacgtcatgggcatgttccggctctgg
tgcgtgcccgagggcgcctccgcggccgagggcacctacgtcaggttcgaccacgagggc
atggtgggcacgctcgccctggccgcccaccgggcggacgccgtcgtggtcggggaggac
ctgggcaccgtggagccgtgggtgcgcgaacacctcgccgaccgcgggatcctcggtacc
tccgtgctgtggttcgagcaggacgccgacggccgcccgcgcccgccggaggagtggcgc
accgactgcctggccacggtcgccacccacgacctgccgccggtggcgtcgttcctgtcc
accgagcacgtcgagctgcgcgaccggctgggcctgctcggccgccccgtggaggaggag
cgcgccgacgccgagtcgcgggtggaacgctggcgcgagctcctcgtggagctgggcctg
ctcgacgaggacgtggaccccgtggccgactcggccgccgtggtggcggccatgcacgcc
tacctggtggccacccccgcccgcatgatcggggtcgcgctcaccgacgtggtgggggag
cggcgcatgcagaaccagcccggcaccagcgacgagtacccgaactggcgcatcccgctc
accagcggcgagggagagccggtcctggtggacgaactgctcgccgacccgcgcatggtg
gcgcgcatccgccgcaccctcgggcctgtcggccggcgggaccacgctccctaa

DBGET integrated database retrieval system