KEGG   Nocardiopsis dassonvillei: Ndas_3483Help
Entry
Ndas_3483         CDS       T01248                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
nda  Nocardiopsis dassonvillei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADH68884
UniProt: D7B489
Position
1:4175243..4175878
Genome map
AA seq 211 aa AA seqDB search
MTRLILVRHGETEWNGERRLQGQQDIGLSEAGRRQVAALAETVRYLDPGYVVTSALRRTR
ETAEVLGVSPHARDPRLNEAYLAGWEGRYSAQIKEEDGGVYAAWRAGRFHPPGAESFGEL
TDRVVEGIGAAARRAHADGHGTLLAVTHGGPVRAFLLAAVGLDPARTVPSHPASLSILDV
DPGAASLTEPGAARLRLFNYSPAMSPLDPPD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggctgatcctggtccgccacggcgagaccgagtggaacggagagcgccgcctc
caggggcagcaggacatcgggctgtcggaggccggacgccgccaggtcgccgcgctggcg
gagacggtccgctatctggaccccggctacgtcgtcacctccgcgctgcgccgcacgcgg
gagaccgccgaggtcctcggggtcagcccgcacgcgcgcgacccccggctcaacgaggcc
tacctggccgggtgggaggggcggtactcggcgcagatcaaggaggaggacggcggtgtg
tacgccgcgtggcgcgcggggcggttccatcccccgggcgcggagagcttcggcgaactc
accgaccgggtggtcgaggggatcggcgccgccgcccgccgggcgcacgccgacggccac
gggacgcttctggccgtcacccacggggggccggtgcgggccttcctcctggccgccgtc
gggctcgacccggcgcgcacggtgcccagccacccggccagtctgagcatcctggacgtc
gaccccggggccgcgtccctcaccgaaccgggtgcggccaggctccggctgttcaactac
tccccggcgatgtcgccgctggacccgccggactga

DBGET integrated database retrieval system