KEGG   Nocardiopsis dassonvillei: Ndas_3483Help
Entry
Ndas_3483         CDS       T01248                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_3483
   01230 Biosynthesis of amino acids
    Ndas_3483
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_3483
  Energy metabolism
   00680 Methane metabolism
    Ndas_3483
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_3483
Enzymes [BR:nda01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Ndas_3483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4175243..4175878
Genome map
AA seq 211 aa AA seqDB search
MTRLILVRHGETEWNGERRLQGQQDIGLSEAGRRQVAALAETVRYLDPGYVVTSALRRTR
ETAEVLGVSPHARDPRLNEAYLAGWEGRYSAQIKEEDGGVYAAWRAGRFHPPGAESFGEL
TDRVVEGIGAAARRAHADGHGTLLAVTHGGPVRAFLLAAVGLDPARTVPSHPASLSILDV
DPGAASLTEPGAARLRLFNYSPAMSPLDPPD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggctgatcctggtccgccacggcgagaccgagtggaacggagagcgccgcctc
caggggcagcaggacatcgggctgtcggaggccggacgccgccaggtcgccgcgctggcg
gagacggtccgctatctggaccccggctacgtcgtcacctccgcgctgcgccgcacgcgg
gagaccgccgaggtcctcggggtcagcccgcacgcgcgcgacccccggctcaacgaggcc
tacctggccgggtgggaggggcggtactcggcgcagatcaaggaggaggacggcggtgtg
tacgccgcgtggcgcgcggggcggttccatcccccgggcgcggagagcttcggcgaactc
accgaccgggtggtcgaggggatcggcgccgccgcccgccgggcgcacgccgacggccac
gggacgcttctggccgtcacccacggggggccggtgcgggccttcctcctggccgccgtc
gggctcgacccggcgcgcacggtgcccagccacccggccagtctgagcatcctggacgtc
gaccccggggccgcgtccctcaccgaaccgggtgcggccaggctccggctgttcaactac
tccccggcgatgtcgccgctggacccgccggactga

DBGET integrated database retrieval system