KEGG   Nocardiopsis dassonvillei: Ndas_3649Help
Entry
Ndas_3649         CDS       T01248                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nda00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4377867..4379366
Genome map
AA seq 499 aa AA seqDB search
MSQQYVAAIDQGTTSSRCILFDRDGRIVSVDQREHRQIFPKPGWVEHDATEIWTNVEAVI
RGALDKNDITPDQIAAVGITNQRETTLVWDRETGEPVHNAIVWQDTRTDDLVRELGGEEG
QDRFRDRCGLPLATYFSGPKLRWLLDNVDGLRERAERGEVLFGTMDTWIIWKLTGRHVTD
VTNASRTMLMNLSTLQWDPEILEAIGVPEGVLPEIRSSSEVYGEARGYLAGTPVASSLGD
QHAALFGQTCFDPGDVKGTYGTGTFLVMNTGTEPVTSENGLLTTLGYKLGDEPAVYALEG
SIAVTGSLVQWLRDNLGLISTAPEIETLARTVEDNGGCYIVPAFSGLFAPHWRSDARGVM
AGLTGYVNKGHIARAVLEATAWQTREVVDAMNADAPTELTTLKVDGGMTADNLLMQILSD
VLDTEVVRPMVAETTCLGAAYAAGLAVGYWPDVETLRANWHKAAEWTPKMEPAVREREYR
NWNKAVRRTLDWVEHEDAQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcagtacgtcgccgcgatcgaccagggcaccacgtcgagccgctgcatcctc
ttcgaccgcgacggacgtatcgtctcggtcgaccaacgcgaacacaggcagatcttcccc
aagccgggctgggtcgaacacgacgccacggagatctggaccaacgtcgaggcggtcatc
aggggagccctggacaagaacgacatcacccccgaccagatcgcggccgtcggcatcacc
aaccagcgcgagaccaccctggtctgggaccgcgagacgggcgagccggtccacaacgcc
atcgtctggcaggacacccgcaccgacgacctggtccgcgaactgggcggcgaggagggc
caggaccgcttccgcgaccggtgcggcctgccgctggccacctacttctccggccccaag
ctgcgctggctgctggacaacgtcgacggcctgcgcgaacgcgccgagcgcggcgaggtc
ctgttcggcaccatggacacctggatcatctggaagctgaccggccgccacgtcaccgac
gtgaccaacgccagccgcaccatgctgatgaacctgtccaccctccagtgggatcccgag
atcctggaggccatcggcgtccccgagggcgtcctgcccgagatccgctcgtcgtcggag
gtctacggcgaggccaggggatacctggccggaacccccgtcgcctcctccctcggcgac
cagcacgccgccctgttcggccagacctgcttcgacccgggcgacgtcaagggcacctac
ggcaccggtaccttcctggtgatgaacaccggcaccgagccggtgacctccgagaacggc
ctgctcaccacgctgggatacaagctcggcgacgaaccggccgtgtacgccctggagggc
tccatcgcggtgaccggctccctcgtgcagtggctgcgcgacaacctgggcctgatctcc
accgcgcccgagatcgagacgctggcgcgcaccgtggaggacaacggcggctgctacatc
gtgcccgccttctccggcctgttcgccccgcactggcgcagcgacgcgcgcggcgtcatg
gcgggcctgaccggttacgtcaacaagggccacatcgcccgcgccgtcctggaggccacc
gcgtggcagacccgcgaggtcgtcgacgcgatgaacgccgacgcgcccacggagctgacc
acgctcaaggtggacggcggcatgaccgccgacaacctgctcatgcagatcctgtccgac
gtgctcgacaccgaggtcgtgcgtccgatggtcgccgagaccacctgcctgggcgccgcc
tacgccgcggggctggcggtgggctactggcccgacgtcgagacgctgcgcgccaactgg
cacaaggccgccgagtggactccgaagatggagcccgccgtgcgcgagcgcgagtaccgc
aactggaacaaggccgtgcgccgcaccctggactgggtcgagcacgaggacgcccagtag

DBGET integrated database retrieval system