KEGG   Nocardiopsis dassonvillei: Ndas_3729Help
Entry
Ndas_3729         CDS       T01248                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ndas_3729
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Ndas_3729
Enzymes [BR:nda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ndas_3729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4477940..4479616)
Genome map
AA seq 558 aa AA seqDB search
MKLSVPHALAPACVGLALIATACTTEEVGSSQEDRATQPSAEAEPFEPVLAPRLLSEMDL
DDKIGQLLVLTAQGTSAAENAAQIEAYRPGGLIYFDANLTDAEQIATMSAGVQDLAADQG
RGVPLFVGIDQEQGLVARLPVGTRFPDAMAVGATRDTELAELRASTTAEELTALGVNLNY
APDADVNTDPGNPVIGIRSFGSDPDLVAQMAVAESDAYSGAGVVSVVKHFPGHGDTDVDS
HSGLPVIDMPREQWEAGHLPPFRAAIDADVDAIMTAHVLMPQLDGSEDPEPATISPELID
GILRDELGYDGVVTTDALNMEGVRQRHSDGEIAVRVLEAGVDQLLMPPDPAAAVSAIREA
VEQGRLTEERIDESVLRVLALKEKRGILEAEPVDAQGAAAVLEDPEHAEAAQRVADASAT
LLRNEGDLLPLAEGSGVRVQGVGAEQIAAALTEAGIDVVESGADAVVVGTGGGSGASEQS
GLVQAARAEGLPVVVVSQGTPYDLAAFPEAEAFVAVYSSMDVSRAAAARVVAGQVKPSGK
LPVDIPAADVEIGTGLTT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtccgttccgcacgccctggccccggcctgcgtgggactcgcactgatcgcc
accgcatgcaccacagaggaggtgggttcctcgcaggaggaccgcgcaacccagccgtcg
gccgaggccgagcccttcgagcccgtgctcgcaccccggctgctgtccgagatggacctg
gacgacaagatcggccagctcctcgtcctgaccgcgcagggcacctcggccgccgagaac
gcagcccagatcgaggcctaccggcccggcggcctcatctacttcgacgccaacctcacc
gacgccgagcagatcgccaccatgtcggcgggcgtgcaggacctcgccgccgaccagggg
cggggcgttccgctgttcgtcggcatcgaccaggagcagggcctggtggcccggctgccc
gtgggcacccgcttccccgacgccatggccgtcggcgccacccgcgacaccgagctggcc
gagctgcgcgcctccaccaccgccgaggagctcaccgccctgggagtcaacctcaactac
gcgcccgacgccgacgtcaacaccgaccccggcaacccggtcatcggcatccgctccttc
ggatccgaccccgatctggtcgcgcagatggccgtcgccgagtcggacgcctactccggc
gccggtgtggtgtcggtggtcaagcacttccccgggcacggcgacaccgacgtggacagc
cacagcggcctgcccgtcatcgacatgccgcgcgagcagtgggaggccgggcacctgccg
ccgttccgggcggccatcgacgccgacgtggacgccatcatgaccgcccacgtgctcatg
ccgcagctggacgggagcgaggaccccgagcccgccaccatctccccggagctgatcgac
ggcatcctccgcgacgagctgggctacgacggcgtggtgaccaccgacgccctcaacatg
gagggtgtgcgccagcgccactccgacggcgagatcgccgtgcgcgtgctggaggcgggc
gtggaccagctgctcatgccgccggaccccgccgccgcggtgtccgcgatccgcgaggcc
gtcgagcagggccgcctgaccgaggagcgcatcgacgagtccgtgctgcgcgtcctggcg
ctcaaggagaagcgcgggatcctggaggccgaaccggtggacgcgcagggcgccgcggcg
gtcctggaggaccccgagcacgccgaggccgcccagcgcgtggcggacgcctccgcgacc
ctgctgcgcaacgagggcgacctgctgcccctggccgagggcagcggagtccgcgtccag
ggggtgggcgcggagcagatcgcggccgcgctcaccgaggccgggatcgacgtggtggag
agcggggccgacgccgtggtcgtgggcaccgggggcggcagcggggcctcggagcagagc
ggcctggtccaggccgcgcgcgccgaggggctgccggtggtcgtggtgtcccagggcacg
ccctacgacctggcggccttcccggaggcggaggcgttcgtggcggtgtactcgtccatg
gacgtgtcgcgggcggccgccgcgcgggtcgtcgccggacaggtgaagccctccggcaag
ctgccggtggacatccccgcggccgacgtggagatcgggaccgggctgaccacctga

DBGET integrated database retrieval system