KEGG   Nocardiopsis dassonvillei: Ndas_3768Help
Entry
Ndas_3768         CDS       T01248                                 

Definition
F420 biosynthesis protein FbiB, C-terminal domain-containing protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:nda00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4526634..4527929
Genome map
AA seq 431 aa AA seqDB search
MSTELRVRGLGGIPEVRSGDDLSALVAEAVAASGTALADGDILVVTSKIVSKAEGRARRM
DREEAVASETVRVVARTGRTGIMQTRQGLVMAAAGVDASNVEPGTVLLLPEDSDASARAL
RAGLRERLGVNVGVIVSDTFGRPWRIGQTDVAIGAAGLSAVQDLRGTADTHGNLMEATVN
AVADEIAGAGELVKGKTNGVPVAVVSGLGGLVTEEDGPGAAVLIRTPEADLFRYGSRDVV
PARRTVRSFTDAPVDPAAVRRAVAAAVTAPAPHHTTPWRFVLVESAHTRKRLLDAMLAAW
VADLRGDGFSEEQIARRTRRGDVLRGAPYLVVPFLVADGAHPYPDARRADAERSMFLVAM
GAGVQNLLVGLAVEGLGSAWVSSTMFCADVVREVLEVPEEWRPMGAVAVGHAAEAPKERP
PRDPEDFVAVR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgaactgcgcgtgcgcgggctcggcggcatccccgaggtgcggtcgggcgac
gacctgtcggccctggtcgccgaggcggtggccgcctccgggaccgcgctggccgacggg
gacatcctcgtggtcacctccaagatcgtgagcaaggccgagggccgcgcccgccgtatg
gaccgggaggaggccgtcgcctccgaaaccgtccgggtggtggcccgcacgggcaggacc
gggatcatgcagacccggcaggggctggtcatggccgccgcgggggtggacgcctccaac
gtcgagcccggcaccgtgctgctgctgcccgaggactccgacgcctccgcccgcgcgctg
cgcgccgggctgcgcgagcgcctgggcgtgaacgtcggtgtgatcgtgtccgacaccttc
gggcggccgtggcggatcgggcagaccgacgtggccatcggcgccgccgggctgtccgcc
gtgcaggacctgcgcggcaccgccgacacccacggcaacctcatggaggcgaccgtcaac
gcggtggccgacgagatcgccggcgcgggcgaactggtcaagggcaagacgaacggtgtc
ccggtcgcggtggtcagcggcctgggcggcctggtcaccgaggaggacggtcctggggcg
gcggtgctgatccgcacgcccgaggccgacctgttccggtacgggtcgcgggacgtggtc
ccggcccggcggacggtgcgctcgttcaccgacgcgccggtggatccggcggcggtgcgg
cgggcggtggccgcggcggtgacggcccccgcgccgcaccacaccacgccgtggcgcttc
gtgctggtggagtcggcgcacacgcgcaagcggctgctggacgcgatgctcgcggcgtgg
gtggcggacctgcgcggtgacgggttcagcgaggagcagatcgcccggcgcacgcggcgc
ggcgacgtgctgcgcggcgcgccgtacctggtggtgcccttcctggtggccgacggggcg
cacccctacccggacgcgcgccgggccgacgccgagcggtcgatgttcctggtggcgatg
ggcgccggggtgcagaacctgctggtggggctggccgtggaggggctggggtcggcctgg
gtctcctcgaccatgttctgcgcggacgtggtgcgcgaggtgctggaggtgcccgaggag
tggcggccgatgggcgcggtggccgtggggcacgcggccgaggcgccgaaggagaggccg
ccgcgcgacccggaggacttcgtcgccgtgcgttag

DBGET integrated database retrieval system