KEGG   Nocardiopsis dassonvillei: Ndas_3839Help
Entry
Ndas_3839         CDS       T01248                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nda03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4604627..4606879)
Genome map
AA seq 750 aa AA seqDB search
MPDATFRPAVVQGVLERVTYANEENGYTVAKVDTGRGAHDLLTVVGSLMGVQPGEALRMR
GRWGSHPQYGRQFHVDDYTTVLPATVQGIRRYLGSGLIKGIGPKMAERIVDHFGTDALEV
IEEHPERLIEVPGLGPKRTRLIADAWEEQKAIKEVMVFLQGVEVTTSLAVRIYKKYGDAS
IQIVQKEPYRLATDVWGIGFKTADTIARAVGIPHDSPQRVMAGIQFTLSESTGDGHVYLP
EEKLISAAVKILQVEAGLVIECVAELVATEGVVRETVPGPEGEPVRAVYLLPMHRAEIGL
ASGLRGLLHAPADRMPAFAGVDWDVALDWLRSRTRADLAEAQREAVRLALSEKVCVLTGG
PGCGKSFTVASIVTLAMAKRATIVLAAPTGRAAKRLTEMTGIEARTVHRLLELRPGGDAA
YDRDNPLDCDLLVVDEASMLDVILANKLVKAVPPGAHLLFVGDVDQLPSVGAGQVLRDLL
DGDSPVPSVRLTHVFRQAQNSGVITNAHRINGGEPPEFHGMSDFFLFPCEESEDAAEMTV
DVVARRIPRRFGLDPRRDVQVLTPMKGGPAGAANLNTALQAAVTPSGEHVPERRFGGRVF
RVGDKVTQVRNNYDKGENGVFNGTLGVVTGLDEVAQEVLVRTDEDEEIAYDFAELDELAH
AYAITVHRSQGSEYPAVVVPVTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRRALAQAVRN
ASSGRRHTALAHRLRSAGRPPEEPPPPDAP
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacgcgaccttccgaccagccgtcgtccagggcgtcctggagcgggtcacctac
gccaacgaggagaacggctacaccgtcgccaaggtcgacacgggccggggcgcgcacgac
ctcctcaccgtcgtgggctccctcatgggagtccagcccggcgaggcgctgcgcatgcgc
ggccgctggggctcccacccgcagtacggccgccagttccacgtggacgactacacgacc
gtcctgcccgccacggtccagggcatccgccgctacctcggctccggcctgatcaagggg
atcggccccaagatggccgagcggatcgtcgaccacttcggcaccgacgccctggaggtc
atcgaggagcatccggaacggctcatcgaggtcccgggcctggggcccaagcgcacccgg
ctcatcgccgacgcctgggaggagcagaaggccatcaaggaggtgatggtcttcctccag
ggcgtggaggtcaccacctccctggccgtgcgcatctacaagaagtacggcgacgcctcc
atccagatcgtgcagaaggagccctaccgcctggccaccgacgtgtgggggatcggcttc
aagaccgccgacaccatcgcccgagcggtcggcatcccgcacgacagcccgcagcgggtc
atggcgggtatccagttcaccctctcggagtccaccggcgacgggcacgtctacctgccc
gaggagaagctcatctcggcggccgtgaagatcctccaggtggaggccgggctggtgatc
gagtgcgtggccgaactcgtggccaccgagggcgtggtgcgcgagaccgtgcccgggccc
gagggcgagccggtgcgcgccgtctacctgctgcccatgcaccgcgccgagatcggtctc
gcctccggcctgcgcggcctgctccacgccccggccgaccgcatgcccgcgttcgccggg
gtggactgggacgtggccctggactggctgcgctcgcgcacgcgcgccgacctcgccgag
gcccagagggaggccgtgcggctggccctgtcggagaaggtgtgcgtgctcaccggcggg
cccggctgcggcaagtccttcacggtcgcctccatcgtcaccctggccatggccaagcgc
gccacgatcgtcctggccgcgcccaccgggcgcgccgccaagcgcctcaccgagatgacc
ggcatcgaggcccgcacggtgcaccggctcctcgaactccgcccgggcggcgacgccgcc
tacgaccgggacaaccccctcgactgcgacctgctggtggtggacgaggcctccatgctg
gacgtgatcctggccaacaagctggtcaaggcggtcccgcccggggcgcacctgctgttc
gtcggcgacgtggaccagctgccctccgtgggcgcgggccaggtgctgcgcgacctgctg
gacggggactcgcccgtgccgagcgtgcgactgacccacgtcttccgccaggcccagaac
tccggggtgatcaccaacgcccaccggatcaacggcggcgagccgccggagttccacggt
atgtccgacttcttcctcttcccctgcgaggagtccgaggacgcggccgagatgaccgtg
gacgtggtcgcccgccgcatcccgcgccggttcggcctcgacccgcgccgggacgtccag
gtcctcacccccatgaagggcggcccggccggggcggccaacctcaacacggccctccag
gccgccgtgacgccctccggcgagcacgtccccgaacgccggttcggcgggcgcgtcttc
cgcgtcggagacaaggtcacccaggtccgcaacaactacgacaagggcgagaacggggtg
ttcaacggaacgctcggcgtggtcacggggctcgacgaggtcgcccaggaggtcctggtc
cgcaccgacgaggacgaggagatcgcctacgacttcgccgaactcgacgagctcgcccac
gcctacgccatcaccgtgcaccgctcccagggcagcgagtaccccgcggtggtcgtgccg
gtcaccaccagcgcctggatgatgctccagcgcaacctgctctacacggccgtcacgagg
gccaagaagctggtggtcctggtcggctcccgccgcgccctggcccaggcggtgcgcaac
gcctcctccgggcgcaggcacacggccctggcgcaccggctgcggtcggccggtcggccg
ccggaggagcccccgcccccggacgccccctga

DBGET integrated database retrieval system