KEGG   Nocardiopsis dassonvillei: Ndas_3991Help
Entry
Ndas_3991         CDS       T01248                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Ndas_3991
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ndas_3991
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Ndas_3991
Lipid biosynthesis proteins [BR:nda01004]
 Desaturase
  First
   Ndas_3991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4774309..4775271
Genome map
AA seq 320 aa AA seqDB search
MTAAPELPTKTTEPKREAIPEYEPELRGRAERYTVFAFVFVPLIALLASLPFFWGWGLSL
TDIAIASVFYLISGLGITVGFHRHFTHGSFKAKRPLRIALAIAGSMAIEGSVIKWVADHR
RHHKYADAEGDPHSPWRFGDDWKSVAKGLYYAHMAWMYLDEKKTSPRRFAPDLLKDKDIV
LVDKLFGLIVVFSLGAPALIGGLVTMSWWGAFTAFFWASLVRMALLHHVTWSINSICHTI
GEENFEVRDRSRNVWWLAIPSFGESWHNLHHADPTCARHGVLKGQIDISARVIWVFEKLG
WASKVRWPNNERLAAKRVSV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgctcccgagctaccgaccaagacgacagagccaaagcgcgaggcgatcccc
gagtacgagcccgaactgcgcggcagggccgagcgctacacggtcttcgcgttcgtgttc
gtgccgctgatcgccctgctggcctcgctgcccttcttctggggttggggcctgtccctg
accgacatcgccatcgcctcggtcttctacctgatcagcggcctgggcatcacggtcggc
ttccaccgccacttcacgcacggctcgttcaaggccaagcgcccgctgcgcatcgcgctc
gcgatcgccggttcgatggccatcgagggcagcgtcatcaagtgggtcgccgaccaccgc
cgccaccacaagtacgccgacgccgagggcgacccgcactcgccgtggcgcttcggcgac
gactggaagtcggtcgccaagggcctgtactacgcgcacatggcgtggatgtacctggac
gagaagaagacctcgccgcgccgcttcgcccccgacctgctcaaggacaaggacatcgtc
ctggtcgacaagctcttcgggctgatcgtggtcttctccctgggcgccccggcgctcatc
ggcggcctggtcaccatgtcctggtggggcgcgttcaccgccttcttctgggccagcctg
gtgcgcatggccctgctgcaccacgtcacctggtcgatcaactccatctgccacaccatc
ggcgaggagaacttcgaggtgcgcgaccgctcccgcaacgtgtggtggctggccatcccg
tccttcggcgagtcctggcacaacctgcaccacgccgaccccacctgcgcccgccacggc
gtgctcaagggccagatcgacatctccgcccgcgtcatctgggtcttcgagaagctcggc
tgggcctccaaggtccgctggcccaacaacgagcgactcgccgccaaacgggtcagcgtc
tag

DBGET integrated database retrieval system