KEGG   Nocardiopsis dassonvillei: Ndas_3991Help
Entry
Ndas_3991         CDS       T01248                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nda01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nda01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4774309..4775271
Genome map
AA seq 320 aa AA seqDB search
MTAAPELPTKTTEPKREAIPEYEPELRGRAERYTVFAFVFVPLIALLASLPFFWGWGLSL
TDIAIASVFYLISGLGITVGFHRHFTHGSFKAKRPLRIALAIAGSMAIEGSVIKWVADHR
RHHKYADAEGDPHSPWRFGDDWKSVAKGLYYAHMAWMYLDEKKTSPRRFAPDLLKDKDIV
LVDKLFGLIVVFSLGAPALIGGLVTMSWWGAFTAFFWASLVRMALLHHVTWSINSICHTI
GEENFEVRDRSRNVWWLAIPSFGESWHNLHHADPTCARHGVLKGQIDISARVIWVFEKLG
WASKVRWPNNERLAAKRVSV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgctcccgagctaccgaccaagacgacagagccaaagcgcgaggcgatcccc
gagtacgagcccgaactgcgcggcagggccgagcgctacacggtcttcgcgttcgtgttc
gtgccgctgatcgccctgctggcctcgctgcccttcttctggggttggggcctgtccctg
accgacatcgccatcgcctcggtcttctacctgatcagcggcctgggcatcacggtcggc
ttccaccgccacttcacgcacggctcgttcaaggccaagcgcccgctgcgcatcgcgctc
gcgatcgccggttcgatggccatcgagggcagcgtcatcaagtgggtcgccgaccaccgc
cgccaccacaagtacgccgacgccgagggcgacccgcactcgccgtggcgcttcggcgac
gactggaagtcggtcgccaagggcctgtactacgcgcacatggcgtggatgtacctggac
gagaagaagacctcgccgcgccgcttcgcccccgacctgctcaaggacaaggacatcgtc
ctggtcgacaagctcttcgggctgatcgtggtcttctccctgggcgccccggcgctcatc
ggcggcctggtcaccatgtcctggtggggcgcgttcaccgccttcttctgggccagcctg
gtgcgcatggccctgctgcaccacgtcacctggtcgatcaactccatctgccacaccatc
ggcgaggagaacttcgaggtgcgcgaccgctcccgcaacgtgtggtggctggccatcccg
tccttcggcgagtcctggcacaacctgcaccacgccgaccccacctgcgcccgccacggc
gtgctcaagggccagatcgacatctccgcccgcgtcatctgggtcttcgagaagctcggc
tgggcctccaaggtccgctggcccaacaacgagcgactcgccgccaaacgggtcagcgtc
tag

DBGET integrated database retrieval system