KEGG   Nocardiopsis dassonvillei: Ndas_3995Help
Entry
Ndas_3995         CDS       T01248                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00480  Glutathione metabolism
nda00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Ndas_3995
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ndas_3995
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ndas_3995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin Cyt_b-c1_8
Motif
Other DBs
NCBI-ProteinID: ADH69392
UniProt: D7B7J7
Position
1:complement(4777836..4778330)
Genome map
AA seq 164 aa AA seqDB search
MSDLDEIPVTLIDGRETTFGEWSGKVRLVVNVASRCGYTPQYERLEKLQHRYGDRGFTVL
GVPSNQFLQEFGSEEKIAEYCSATWGVTFPMTAKAKLNGKQQHPLYAALSSAEDEDGKAG
KVKWNFEKFLVLPDGAVHRFRSSTEPDDPGITALIEKALPGDAG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctggacgagatcccggtgaccctgatcgacggacgcgagacgacgttcggc
gagtggtcgggcaaggtgaggctggtggtcaacgtcgcctcgcgctgcggctacaccccg
cagtacgagcggctggagaagctccagcaccggtacggcgaccgggggttcaccgtgctc
ggcgtgcccagcaaccagttcctccaggagttcggcagcgaggagaagatcgcggagtac
tgctcggccacctggggcgtcaccttccccatgacggccaaggccaagctcaacggcaag
cagcagcacccgctctacgcggcgctctcctccgccgaggacgaggacggcaaggcgggg
aaggtcaagtggaacttcgagaagttcctcgtcctccccgacggcgccgtgcaccgcttc
cgcagctcgaccgagcccgacgaccccgggatcaccgcgctcatcgagaaggcgctcccc
ggcgacgcggggtag

DBGET integrated database retrieval system