KEGG   Nocardiopsis dassonvillei: Ndas_4003Help
Entry
Ndas_4003         CDS       T01248                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_4003
   01230 Biosynthesis of amino acids
    Ndas_4003
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ndas_4003
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Ndas_4003
Enzymes [BR:nda01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Ndas_4003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4786869..4787579)
Genome map
AA seq 236 aa AA seqDB search
MDMTTATALSRYADLPALIGLMEGDEKHNGAAHSTLDIVWVLYDRVLSVTPETADDPARD
RFLLSKGHGPAAFYAVLAAKGFLDVPTLRGWTAFDSPLGHHPDRLLVPGAEIGSGSLGHG
LPLGLGSALGLRAQGVRRSDGTEPRVVVLVGDGELDEGSNHEAIAVAGRLGVDNLTVVAV
DNASASHGWPGGIGARFGIEGWEARDVSGRDHDALYGALTRPHPGRPLAVVARVRS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtggacatgaccaccgcaaccgctctctcgcgctacgccgacctgccggccctcatcgga
ctcatggagggtgacgagaagcacaacggggcggcccactcgacactcgacatcgtgtgg
gtgctctacgaccgtgtgctgtccgtcacccccgagaccgccgacgatcccgcacgggac
cggttcctgctctccaaggggcacggccccgccgccttctacgccgtgctcgcggccaag
ggcttcctggacgtgccgacgctgcgcggctggaccgccttcgactcaccgctcggccac
cacccggaccggctgctcgtgccgggcgcggagatcggcagcgggtcgctcggccacggg
ctgcccctgggcctgggcagcgcgctcggcctgcgcgcccagggcgtccgccgctccgac
gggaccgaaccccgcgtcgtggtgctcgtcggcgacggcgaactcgacgagggcagcaac
cacgaggccatcgccgtcgccggacggctcggcgtggacaacctcaccgtcgtcgccgtg
gacaacgcctccgccagccacggatggccgggcgggatcggcgcccgcttcgggatcgag
ggctgggaggcccgcgacgtctccggccgcgaccacgacgccctgtacggggcgctcacc
cggccccaccccggacggccgctggccgtcgtcgcccgcgtccgttcctag

DBGET integrated database retrieval system