KEGG   Nocardiopsis dassonvillei: Ndas_4004Help
Entry
Ndas_4004         CDS       T01248                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00900  Terpenoid backbone biosynthesis
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01130  Biosynthesis of antibiotics
Module
nda_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ndas_4004
Enzymes [BR:nda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ndas_4004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADH69401
UniProt: D7B7K6
Position
1:complement(4787657..4788637)
Genome map
AA seq 326 aa AA seqDB search
MTVNTTVTVRVPAKVNLQLAVGPRREDGFHDLVNVFHAVSLFDEVTVQAASSRRPSPPGG
VGSAAEAFAGLTAGGALGSHLSRVPLDGSNLAARAVTLLAERTGRGLPVTVHLDKNIPVA
GGMAGGSADAAAALLACDRLWGCGLPLEELLGYAADLGSDVPFALLGATAVGMGRGEVLR
PMTSPGRFRWVFALSPHGLSTASVFAEYDRIRPDAPEPLLDRGLADALAGGDPAALGAAL
TNDLQEAALSLLPELERTLKTGAGAGALGSLVSGSGPTCAFLVGGGAERESVVAEREAAV
VAALEGSGLCEQVVTAYGDVPGAAVL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttaataccaccgtaaccgtgcgggtccccgcgaaggtgaacctccagttggcg
gtggggcccagacgtgaggacgggttccacgacctcgtcaacgtgttccacgccgtctcg
ctgttcgatgaggttaccgtccaggcggcttcctcgcgccgaccgagcccgcccggcggt
gtcggatcggccgccgaagccttcgccggactgaccgcgggcggcgcgctggggtcccac
ctgtcccgggtgcccctggacgggtccaacctggccgcgcgcgcggtgaccctgctggcg
gagcggaccggccggggcctccccgtcacggtccacctggacaagaacatcccggtggcg
ggcggcatggccgggggcagcgcggacgccgcggccgccctgctggcctgcgaccgtctg
tggggctgcggcctgccgctggaggaactgctcgggtacgcggccgacctgggcagcgac
gtccccttcgcgctgctgggcgccaccgcggtgggcatggggcgcggggaggtcctgcgg
ccgatgaccagtccgggaaggttccgctgggtcttcgccctgtcgccgcacggcctgtcc
acggccagcgtgttcgccgagtacgaccgcatccgcccggacgcccccgagcccctgctg
gaccgggggctggccgacgcgctcgccggcggcgacccggcggccctgggagccgcgctg
accaacgatctccaggaggccgcgctctcgctgctgcccgagctggagcgcaccctcaag
accggcgccggtgcgggggcgctgggctccctggtgtcggggtccggtccgacctgcgcc
ttcctggtcggcggcggcgccgagcgggagtcggtcgtcgcggagcgggaggccgcggtg
gtggcggcgctggagggcagcgggctgtgcgaacaggtcgtgacggcgtacggggacgtc
cccggggccgccgtcctgtga

DBGET integrated database retrieval system