KEGG   Nocardiopsis dassonvillei: Ndas_4087Help
Entry
Ndas_4087         CDS       T01248                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ndas_4087
   00052 Galactose metabolism
    Ndas_4087
   00500 Starch and sucrose metabolism
    Ndas_4087
   00520 Amino sugar and nucleotide sugar metabolism
    Ndas_4087
Enzymes [BR:nda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ndas_4087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4885377..4886315)
Genome map
AA seq 312 aa AA seqDB search
MNDSTDHKRPSGSVSVTKAVVPAAGLGTRFLPATKATPKEMLPIVDKPAIQYVVEEAVAA
SLQDVLMITGRSKRSIEDHFDRAYELEEALEAKGDDARLRSVRESSDLAQVHYVRQGEPR
GLGHAVLCAEAHVGDNPFAVLLGDDLIESADLLRRMIEVRERHGGSVVALMEVEPEQVSL
YGCAGIEPTDEDDVVTVTDLVEKPAPEQAPSRWAIIGRYVCDPAVFPVLHETPPGRGGEI
QLTDALRELARRKPEDGGTVHGVLFRGRRYDTGNKADYIRTVVDFACRRPDLADELLPWL
SDFVDRARAQRP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccaccgaccacaagcgaccctccggttccgtgtccgtcacgaaggcggtc
gtacccgccgcgggcctgggcacgcgcttcctgcccgcgaccaaggccacgcccaaggag
atgctgccgatcgtggacaagcccgcgatccagtacgtcgtggaggaggcggtggccgcc
tccctccaggacgtcctgatgatcacgggacgcagcaagcgctccatcgaggaccacttc
gaccgggcctacgagctggaggaggcgttggaggccaagggcgacgacgcccggctgcgc
tcggtgcgcgagtccagcgacctcgcccaggtgcactacgtccgccagggcgagccgcgc
ggcctgggccacgcggtgctgtgcgcggaggcgcacgtcggtgacaaccccttcgccgtc
ctgctgggcgacgacctcatcgagtccgccgacctgctgcgccgcatgatcgaggtgcgc
gagcgccacggcggcagcgtcgtcgccctcatggaggtggagcccgagcaggtgtccctg
tacgggtgcgcgggcatcgagcccaccgacgaggacgacgtcgtcaccgtcaccgacctg
gtcgagaagcccgcccccgagcaggcgccgagccgctgggcgatcatcggccgctacgtc
tgcgacccggcggtcttccccgtcctgcacgagaccccgcccggccggggcggtgagatc
cagctgaccgacgccctgcgcgagctggcccggcgcaagcccgaggacggcggtacggtg
cacggcgtcctcttccgcggccgccgctacgacaccggcaacaaggccgactacatccgc
acggtcgtggacttcgcctgccggcgccccgacctcgccgacgaactgctgccctggctg
agcgacttcgtcgaccgcgcgcgggcccagcgcccctga

DBGET integrated database retrieval system