KEGG   Nocardiopsis dassonvillei: Ndas_4158Help
Entry
Ndas_4158         CDS       T01248                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ndas_4158
Enzymes [BR:nda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ndas_4158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4964910..4965815)
Genome map
AA seq 301 aa AA seqDB search
MSAAAPRVAVFGSVNMDLVAYVEQVPASGETVTGTAFRQVPGGKGANQAVAAARAGADVA
FLGAVGEDSFGEDLRANLVGSGIDVSGLRTVPGASGVAHIVVDGGGGNSIIVVPGANGEV
TGVAAGDPGIIGGSAALLLQLELPVEAVVSAARTGRELGVPVYLTPAPARELPAELLESV
DVLVPNQHEAAAITGRAEPREALAALLELVPEVLLTLGEDGSLHGRRGGEPLHVPARRVE
AVDTTAAGDVFCGSFAVARAEGRTPEEAMRFAAAAAALSVQRHGASSSMASRDEVEALLG
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcggcgccgcgcgtggcggtcttcggcagcgtcaacatggacctggtcgcc
tacgtcgaacaggtgcccgccagcggggagacggtcacgggcacggcctttcgccaggtg
cccggcggcaagggcgccaaccaggccgtggccgcggccagggccggggccgacgtggcc
ttcctcggcgcggtgggcgaggactccttcggggaggacctgcgcgccaacctcgtcggc
agcggcatcgacgtgtccgggctgcgcacggtgcccggggcgtcgggggtggcgcacatc
gtcgtggacggcgggggcggcaactcgatcatcgtcgtgcccggggccaacggcgaggtc
accggcgtggccgcgggcgaccccgggatcatcgggggcagcgccgccctgctgctccag
ctcgaactgcccgtggaggcggtggtctcggccgcgcgcaccggccgcgagctgggcgtc
ccggtctacctgaccccggctcccgcacgcgaactgcccgccgaactcctggagtcggtg
gacgtcctggtgcccaaccagcacgaggcggccgcgatcaccggccgcgccgagccgcga
gaggcgctggccgcgctgctggaactggttccggaggtgctgctgaccctgggcgaggac
ggctcgctccacggccgcagagggggcgagccgctgcacgttcccgcgcgccgggtggag
gcggtggacaccacggcggccggggacgtcttctgcgggtcgttcgcggtcgcccgcgcg
gagggccgcacgcccgaggaggccatgcggttcgccgccgcggcggccgcgctctcggtc
cagcggcacggcgccagttcgtcgatggcctcccgggacgaggtcgaggcgctgctgggc
ggctga

DBGET integrated database retrieval system