KEGG   Nocardiopsis dassonvillei: Ndas_4194Help
Entry
Ndas_4194         CDS       T01248                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ndas_4194
Enzymes [BR:nda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Ndas_4194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(5008669..5009982)
Genome map
AA seq 437 aa AA seqDB search
MSRTRIAVGAAVSSVSALALGTALLATAPASAADSEFYVNPNTSAAVWVEENPNDPRADV
IRDRIASVAQATWFTQYNPAEVRDDVDAVVSAADAQGQTPILVVYNIPGRDCGNHSGGGA
PSHDAYRAWVDEVAAGLEGRSATIVLEPDALPLVSGCSDPSELLDSMAYAGKALMEGSSE
ARVYFDIGNSAWLDPQEAAGLLNGADVANSAHGVATNTSNYNWTHDEVAFAEAVIAATGV
PGLGAVIDTSRNGNGPAPQNEWCDPPGRMIGRPSTTDTGNPLIDAFIWTKLPGEADGCIA
PAGQFVPQAAYDMAVNAPEYPTDPGEPTDPEEPTDPPEGEGCTADYRVVSEWGNGFQAAV
TVTAEDSLSGWTVTWTYADGQRFSQGWNAEFSSSGSRVTASDLGWNGTLSAGGSTEFGFT
GTHGGSNGVPEVTCSAA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcacacgcatagccgtcggagcagcagtgagctccgtctcggcactggccctg
ggaacggcgctgctcgccacggcgcccgcctcggccgccgactccgagttctacgtcaac
cccaacacgtcggcggccgtctgggtcgaggagaacccgaacgacccccgggccgacgtc
atccgcgaccgcatcgcctcggtcgcccaggccacctggttcacccagtacaaccccgcc
gaggtccgcgacgacgtggacgcggtggtcagcgccgccgacgcccagggccagaccccc
atcctggtggtctacaacatccccggccgcgactgcggcaaccacagcggcggcggggcg
cccagccacgacgcctaccgcgcctgggtcgacgaggtcgccgcggggctggagggccgg
tccgccaccatcgtcctggagcccgacgccctgccgctggtgagcggctgcagcgacccg
tccgagctcctggactccatggcctacgcgggcaaggcgctcatggagggctcctccgag
gccagggtctacttcgacatcggcaactcggcctggctggacccgcaggaggccgccggc
ctgctcaacggcgcggacgtcgcgaacagcgcgcacggcgtcgccaccaacacctccaac
tacaactggacccacgacgaggtcgccttcgcggaggccgtcatcgccgcgacgggcgtg
cccggcctcggcgccgtgatcgacaccagccgcaacggcaacggccccgccccccagaac
gagtggtgcgacccgccggggcggatgatcggccgccccagcaccaccgacaccgggaac
ccgctgatcgacgccttcatctggaccaagctgcccggtgaggccgacggctgcatcgcg
cccgcggggcagttcgtgccccaggccgcctacgacatggcggtgaacgcccccgagtac
cccaccgaccccggcgagccgaccgaccccgaggagcccaccgacccgcccgagggcgag
ggctgcacggccgactacagggtcgtcagcgagtggggcaacggcttccaggcggcggtg
acggtcaccgccgaggactccctcagcggctggaccgtgacgtggacctacgccgacggg
cagcggttcagccagggctggaacgccgagttctccagcagcgggtcgcgggtcaccgcc
tccgacctcggctggaacggcacgctcagcgccggcggcagcaccgagttcgggttcacc
gggacccacggcggtagcaacggcgtgcccgaggtgacgtgctccgcggcctga

DBGET integrated database retrieval system