KEGG   Nocardiopsis dassonvillei: Ndas_4302Help
Entry
Ndas_4302         CDS       T01248                                 

Definition
formaldehyde dehydrogenase, glutathione-independent (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_4302
  Energy metabolism
   00680 Methane metabolism
    Ndas_4302
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ndas_4302
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Ndas_4302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:5118495..5119715
Genome map
AA seq 406 aa AA seqDB search
MTGNRGVVYRGAGRVEVEDVDYPEFVIKDGPGVNPANVGRKVPHGAILKVVATNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVVETGPGVEFVKVGDLVSVPFNISCGRCRNCKARRTEI
CLNVNPDRPGSAYGYVDMGGWVGGQARYALVPYADWNLLVFPDRDQALEKILDLTMLSDI
FPTGYHGCVTAGVGVGSSVYVAGAGPVGLAAAASARLLGAAVVIVADMKEERLAQARSFG
CETVNVAEGDLAGQIERILGVPEVDCAVDAVGFEAHGTGEGASKEAPASVLNTAMDVTRA
GGSIGIPGLYVTGDPGASDEAAKEGSLSVRIGLGWSKSHAFFTGQCPVMKYHRELMEAIL
HDRVRIAEAVNAVAIPLEEAPEGYRAFDEGAASKYVLDPNNYLGTR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaacaggggtgtggtgtacaggggagcgggccgggtcgaggtcgaggacgtc
gactaccccgagttcgtcatcaaggacggccccggggtcaacccggcgaacgtcggacgc
aaggtgccgcacggggcgatcctgaaggtcgtcgccaccaacatctgcggaagcgaccag
cacatggtgcgggggcgcaccaccgcgccggaagggctggtcctgggccacgagatcacc
ggcgaggtggtcgagaccggacccggcgtggagttcgtcaaggtcggcgacctcgtctcg
gtcccgttcaacatctcctgcgggcgctgccgcaactgcaaggcgcggcgcacggagatc
tgcctgaacgtgaacccggaccggccgggctcggcctacggctacgtcgacatgggcggc
tgggtcggcgggcaggccaggtacgcgctcgtgccctacgcggactggaacctcctcgtg
ttccccgaccgcgaccaggcgttggagaagatcctggacctgacgatgctctcggacatc
ttcccgaccggctaccacggctgcgtcaccgcgggcgtgggcgtggggtcgagcgtctac
gtcgcgggggccgggcccgtcgggctggccgccgccgcgtcggcccgactgctcggcgcg
gcggtggtgatcgtcgcggacatgaaggaggagcggctggcgcaggcccgcagcttcggg
tgcgagacggtgaacgtggccgagggtgacctggccgggcagatcgagcggatcctgggc
gtccccgaggtggactgcgcggtggacgcggtcggcttcgaggcgcacgggacgggagag
ggagcctcgaaggaggcgcccgccagcgtgctcaacaccgcgatggacgtgaccagggcc
ggggggtccatcgggattccgggcctgtacgtgaccggcgacccaggcgcgtccgacgag
gccgccaaggagggttccctgtcggtccggatcgggctgggctggtcgaagtcgcacgcc
ttcttcaccggccagtgcccggtcatgaagtaccaccgggagctgatggaggcgatcctc
cacgaccgggtgcggatcgccgaggccgtcaacgccgtggcgatcccgctggaggaggcg
cccgaggggtaccgggccttcgacgagggtgcggccagcaagtacgtgctcgacccgaac
aactacctcggcacgcgctga

DBGET integrated database retrieval system