KEGG   Nocardiopsis dassonvillei: Ndas_4333Help
Entry
Ndas_4333         CDS       T01248                                 

Definition
deoxyribodipyrimidine photo-lyase (EC:4.1.99.3)
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
nda  Nocardiopsis dassonvillei
Brite
Enzymes [BR:nda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.3  deoxyribodipyrimidine photo-lyase
     Ndas_4333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(5167848..5169155)
Genome map
AA seq 435 aa AA seqDB search
MASATIVLFTQDLRVHDHPALAAAVERPGPTLPVFVLDPAVAGRSVRNRAALLADALADL
RAALRERGADLVLLRGDTVREVAALARASGADTVHVTDGVSSLAARRARRLRATGLTVRA
FPGLTVVPPGEVTPAGGDHYKVFTPYWKAWEAAAWRDPVAPPDRVVLPEGVRPGELPGRG
TDGLGALAEDLPRGGERAARERLDAWLSSGLAAYPDRHDDLPGAATSHLSADLRLGCLSP
LEAALAASPLAGGEAFVRQLAWRDFHHQVTAAFPAVNVRDYRPRDRKWREDPDALDAWKR
GRTGVPVVDAGMRQLLREGFVHNRARMITAAFLTRTLRVHWREGADHFHAHLVDGDVANN
YGNWQWVAGTGNDTRPNRAFNPLRQARRFDPEGVYVRRYLPELADLPGGRAHTPWREEHP
PPGYPAPIADPGHWG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttggcgtccgccaccatcgtcctgttcacacaggacctccgcgtccacgaccaccccgcc
ctggccgccgcggtcgagcgccccggcccgaccctgccggtcttcgtgctggaccccgcg
gtggccggccggtccgtccgcaaccgagccgccctgctcgccgacgccctcgccgacctg
agggccgcactgcgcgagcgcggcgccgacctggtcctcctccggggcgacaccgtccgt
gaggtcgccgccctggcccgggccagcggggccgacaccgtccacgtcaccgacggcgtc
agctccctcgccgcgcggcgcgcgcgacgcctgcgcgcgaccggcctgaccgtgcgggcc
ttcccggggctcaccgtggtcccgccgggggaggtcaccccggcgggcggcgaccactac
aaggtgttcacgccctactggaaggcctgggaggccgccgcgtggcgcgatccggtcgcg
ccgccggaccgtgtggtcctgcccgagggggtccggcccggcgagctgcccggacgcggg
acggacggtctgggcgcgctcgctgaggacctgccgcggggaggggagcgcgcggcccgc
gagcgcctggacgcctggctgtcgtccgggctggcggcctaccccgaccggcacgacgac
ctgccgggcgcggccacctctcacctgtccgccgacctgcgcctgggctgcctgtcgccg
ttggaggccgccctggccgcctcacccctggccgggggagaggcgttcgtccgccagctc
gcctggcgcgacttccaccaccaggtcaccgcggccttcccggcggtgaacgtccgcgac
taccggccccgggacaggaaatggcgcgaggaccccgacgccttggacgcctggaagcgg
gggcggaccggcgttccggtcgtggacgcaggaatgcgccagctgctgcgcgaggggttc
gtgcacaaccgggcgcgcatgatcaccgcggcgttcctcacccggaccctgcgcgtgcac
tggcgcgagggcgccgaccacttccacgcccacctcgtggacggggacgtggccaacaac
tacggcaactggcagtgggtcgcgggcacgggcaacgacacccggcccaacagggcgttc
aacccgctgcgccaggcccgcaggttcgaccccgagggcgtgtacgtccgccgctacctg
cccgaactggccgatctcccgggcgggcgcgcgcacacgccctggcgggaggagcacccg
ccccccggatatccggcgccgatcgccgaccccggccactggggctga

DBGET integrated database retrieval system